DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment so and ceh-32

DIOPT Version :9

Sequence 1:NP_476733.1 Gene:so / 35662 FlyBaseID:FBgn0003460 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_505958.1 Gene:ceh-32 / 179603 WormBaseID:WBGene00000453 Length:439 Species:Caenorhabditis elegans


Alignment Length:229 Identity:107/229 - (46%)
Similarity:152/229 - (66%) Gaps:17/229 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 TQEQVACVCEVLQQAGNIERLGRFLWSLP--QCDKLQLNESVLKAKAVVAFHRGQYKELYRLLEH 166
            |.:|:...||.|:..|:::.|.||:.::|  :..::..||:.|:|:|:|.||...::|||.:||:
 Worm    69 TADQIVKTCEQLETDGDVDGLFRFMCTIPPQKTQEVAGNEAFLRARALVCFHASHFRELYAILEN 133

  Fly   167 HHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRS 231
            :.||.:.|.|||.:|.:|||.|.||.||:.|.||.|||||:|:|:||||||||:.::||||::||
 Worm   134 NKFSPKYHPKLQEMWHEAHYREQEKNRGKSLCAVDKYRVRKKYPMP
RTIWDGEQKTHCFKERTRS 198

  Fly   232 VLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAA-----------EHKDGSTDK 285
            :||:||..:|||:|.:|::||.|||||..||.|||||||||||||           |.|..|:|.
 Worm   199 LLREWYLKDPYPNPPKKKELANATGLTQMQVGNWFKNRRQRDRAAAAKNKQNIIGVELKKTSSDM 263

  Fly   286 QHLDSSSDSEMEGSMLPSQSAQHQQQQQQQQHSP 319
                |.||.:.|.||..|.|...:.:...:.|.|
 Worm   264 ----SDSDDDFEDSMTDSPSPIDEPKDLSKSHIP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soNP_476733.1 SIX1_SD 103..212 CDD:293483 48/109 (44%)
homeodomain 223..274 CDD:238039 33/50 (66%)
ceh-32NP_505958.1 SIX1_SD 68..179 CDD:293483 48/109 (44%)
homeodomain 187..236 CDD:238039 28/48 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0775
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X333
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.