DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment so and ceh-88

DIOPT Version :9

Sequence 1:NP_476733.1 Gene:so / 35662 FlyBaseID:FBgn0003460 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_503081.2 Gene:ceh-88 / 178514 WormBaseID:WBGene00008195 Length:262 Species:Caenorhabditis elegans


Alignment Length:197 Identity:43/197 - (21%)
Similarity:68/197 - (34%) Gaps:59/197 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 GGSGGRENLPSFGFTQEQVACVCEVLQQAGNIERLGRFLWSLPQCDKLQLNESVLKAKAVVAFHR 154
            |.||.....|....:.::...|.|:....||.                              :|.
 Worm     9 GPSGSAPRKPETWRSCKEANKVIEMFYSEGNF------------------------------YHD 43

  Fly   155 GQYKELYRLLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGE 219
            ...:||..|.|..|.:.::              ...:||.:...| |||..    |.|:.:::  
 Worm    44 IYMEELANLAETSHKNVRD--------------TLSRLRKKDERA-GKYVP----PPPKQMYE-- 87

  Fly   220 ETSYCFKEKSRSVLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAAEHKDGSTD 284
                 |..:.|..|...:...|.......|:|:|.||||..|::|||.|:|   |.|:.:....|
 Worm    88 -----FTSEQRGALDQAFLVTPQMDSDGARELSEITGLTVKQINNWFCNQR---RKADGRSAEKD 144

  Fly   285 KQ 286
            |:
 Worm   145 KK 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soNP_476733.1 SIX1_SD 103..212 CDD:293483 17/108 (16%)
homeodomain 223..274 CDD:238039 17/50 (34%)
ceh-88NP_503081.2 HOX 81..135 CDD:197696 18/63 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.