DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment so and six3

DIOPT Version :9

Sequence 1:NP_476733.1 Gene:so / 35662 FlyBaseID:FBgn0003460 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_002944388.2 Gene:six3 / 100493798 XenbaseID:XB-GENE-478761 Length:295 Species:Xenopus tropicalis


Alignment Length:246 Identity:134/246 - (54%)
Similarity:175/246 - (71%) Gaps:26/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 VVSGGGSGGRE--------NLPSFGFTQEQVACVCEVLQQAGNIERLGRFLWSLP----QCDKLQ 138
            |:..|.|||..        .|||..|:.||||.|||.|::.|:||||||||||||    .|:.:.
 Frog    24 VLLAGSSGGPRAQEELSMFQLPSLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAIN 88

  Fly   139 LNESVLKAKAVVAFHRGQYKELYRLLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKY 203
            .:||:|:|:||||||.|.:::||.:||:|.|:.::|.||||:||:|||.|||||||||||.|.||
 Frog    89 KHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKY 153

  Fly   204 RVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKN 268
            |||:||||||||||||:.::||||::||:||:||..:|||:|.:||:||:|||||.|||.|||||
 Frog   154 RVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKN 218

  Fly   269 RRQRDRAAEHKD-------GSTDKQHL-------DSSSDSEMEGSMLPSQS 305
            ||||||||..|:       |.:..:.|       .||::|....:..|:.|
 Frog   219 RRQRDRAAAAKNRLQHQSIGQSGMRSLADPGCPTHSSAESPSTAAASPTTS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soNP_476733.1 SIX1_SD 103..212 CDD:293483 70/112 (63%)
homeodomain 223..274 CDD:238039 35/50 (70%)
six3XP_002944388.2 SIX1_SD 49..162 CDD:374862 70/112 (63%)
homeodomain 170..218 CDD:238039 29/47 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X333
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.