DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment so and six2

DIOPT Version :9

Sequence 1:NP_476733.1 Gene:so / 35662 FlyBaseID:FBgn0003460 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001093745.1 Gene:six2 / 100101784 XenbaseID:XB-GENE-481504 Length:289 Species:Xenopus tropicalis


Alignment Length:294 Identity:180/294 - (61%)
Similarity:209/294 - (71%) Gaps:38/294 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LPSFGFTQEQVACVCEVLQQAGNIERLGRFLWSLPQCDKLQLNESVLKAKAVVAFHRGQYKELYR 162
            ||:|||||||||||||||||.||||||||||||||.|:.|..||||||||||||||||.::|||:
 Frog     4 LPTFGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYK 68

  Fly   163 LLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKE 227
            :||.|.||..||.|||.|||||||:||||||||||||||||||||||||||:|||||||||||||
 Frog    69 ILEGHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKE 133

  Fly   228 KSRSVLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAAEHKDG-STDKQHLDSS 291
            |||||||:||:|||||||||||:|||||||||||||||||||||||||||.|:. ..:.::.:|:
 Frog   134 KSRSVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERYEENNENSNSN 198

  Fly   292 SDSEMEGSM--------------LPSQSAQHQQQQQQQQHSPGNSSGNNNGLHQQQLQHVAAEQG 342
            |.:.:..||              .||.:..|...      ||......|.||  |.|..::..||
 Frog   199 SHNPLSTSMNGGKTVLGSSDDDKTPSGTPDHTSS------SPALLLSGNPGL--QALHGMSHPQG 255

  Fly   343 -----------LQHHPHQP---HP-ASNIANVAA 361
                       :.||..|.   :| :||:.::.:
 Frog   256 PSAIPVSAADPMHHHTLQDSILNPMSSNLVDLGS 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
soNP_476733.1 SIX1_SD 103..212 CDD:293483 90/108 (83%)
homeodomain 223..274 CDD:238039 47/50 (94%)
six2NP_001093745.1 SIX1_SD 9..118 CDD:374862 90/108 (83%)
homeodomain 129..180 CDD:238039 47/50 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 199 1.000 Domainoid score I3007
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 354 1.000 Inparanoid score I2200
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001063
OrthoInspector 1 1.000 - - otm48580
Panther 1 1.100 - - LDO PTHR10390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X333
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.150

Return to query results.
Submit another query.