DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1701 and CG11113

DIOPT Version :9

Sequence 1:NP_001097209.1 Gene:CG1701 / 35661 FlyBaseID:FBgn0033167 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001097208.1 Gene:CG11113 / 35659 FlyBaseID:FBgn0033165 Length:138 Species:Drosophila melanogaster


Alignment Length:134 Identity:52/134 - (38%)
Similarity:85/134 - (63%) Gaps:2/134 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRLFPVYFAIIFLFQYDVYSISDNLKTELRSWFG-NIKQLHNPATLNTLKMLCVVEVMRGSKHRI 64
            ||...|:.||::|||:::.::.:.: .||:||.. |:|...:..|::||.||||:|:..|.|...
  Fly     1 MRRLAVHIAILYLFQWEIGAVLNKI-NELKSWLDQNVKGRQDSDTIDTLIMLCVIEMKEGKKLPA 64

  Fly    65 NVGNIDILNKNTLENFIKLPSFKMPNITIVIVEDELSKIARSGSQYKEREMEKLVQHFKECILAK 129
            .:.|..|.||||::|:|.||:.|:|||||:..:::|...|||..|..|.:::.|:...|:||..|
  Fly    65 KIANFRITNKNTVQNYIILPTIKIPNITIIFADEKLPVSARSRKQNIEEKLDTLIGFLKDCITKK 129

  Fly   130 LKAL 133
            :..|
  Fly   130 INLL 133



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467098
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016764
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.