DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1701 and CG11113

DIOPT Version :10

Sequence 1:NP_001097209.1 Gene:CG1701 / 35661 FlyBaseID:FBgn0033167 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001097208.1 Gene:CG11113 / 35659 FlyBaseID:FBgn0033165 Length:138 Species:Drosophila melanogaster


Alignment Length:134 Identity:52/134 - (38%)
Similarity:85/134 - (63%) Gaps:2/134 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRLFPVYFAIIFLFQYDVYSISDNLKTELRSWFG-NIKQLHNPATLNTLKMLCVVEVMRGSKHRI 64
            ||...|:.||::|||:::.::.:.: .||:||.. |:|...:..|::||.||||:|:..|.|...
  Fly     1 MRRLAVHIAILYLFQWEIGAVLNKI-NELKSWLDQNVKGRQDSDTIDTLIMLCVIEMKEGKKLPA 64

  Fly    65 NVGNIDILNKNTLENFIKLPSFKMPNITIVIVEDELSKIARSGSQYKEREMEKLVQHFKECILAK 129
            .:.|..|.||||::|:|.||:.|:|||||:..:::|...|||..|..|.:::.|:...|:||..|
  Fly    65 KIANFRITNKNTVQNYIILPTIKIPNITIIFADEKLPVSARSRKQNIEEKLDTLIGFLKDCITKK 129

  Fly   130 LKAL 133
            :..|
  Fly   130 INLL 133

Return to query results.
Submit another query.