Sequence 1: | NP_001097209.1 | Gene: | CG1701 / 35661 | FlyBaseID: | FBgn0033167 | Length: | 134 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097208.1 | Gene: | CG11113 / 35659 | FlyBaseID: | FBgn0033165 | Length: | 138 | Species: | Drosophila melanogaster |
Alignment Length: | 134 | Identity: | 52/134 - (38%) |
---|---|---|---|
Similarity: | 85/134 - (63%) | Gaps: | 2/134 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MRLFPVYFAIIFLFQYDVYSISDNLKTELRSWFG-NIKQLHNPATLNTLKMLCVVEVMRGSKHRI 64
Fly 65 NVGNIDILNKNTLENFIKLPSFKMPNITIVIVEDELSKIARSGSQYKEREMEKLVQHFKECILAK 129
Fly 130 LKAL 133 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45467098 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0016764 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.930 |