DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eaf and eaf1

DIOPT Version :9

Sequence 1:NP_610273.1 Gene:Eaf / 35660 FlyBaseID:FBgn0033166 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_012820413.1 Gene:eaf1 / 780356 XenbaseID:XB-GENE-480964 Length:268 Species:Xenopus tropicalis


Alignment Length:295 Identity:87/295 - (29%)
Similarity:136/295 - (46%) Gaps:74/295 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IGEEVRELKLGATFNPKNTSTAFHTIKYDFKPASVDTSRMASVDVGSNNQVTVTVPNSESSGVPH 80
            :..|...|:||.:|. |...::|||::|||||||:|||....:.||..::||:|:|:...|..|.
 Frog    10 LDREEHILRLGESFE-KRPRSSFHTVRYDFKPASIDTSCEGELQVGKGDEVTITLPHIPGSTPPM 73

  Fly    81 TVYKGNQREYAKECLMIYDKETGAITIEKLNHNIQVKKTRNEVTNKSVQLPGQNMGQPHNQGANG 145
            ||:|||:|.|.|:|::|.:.:||...:|||:.:|||||||.|.::| :|      .:...|.|..
 Frog    74 TVFKGNKRPYQKDCVLIINHDTGEYVLEKLSSSIQVKKTRAEGSSK-IQ------ARIEQQSARA 131

  Fly   146 AAPVAVPVPGQGSGTAPKMENSTMRISTKTKVSTGSRRNNIIDFKPRNSPMQQNSPSRPVPVHRS 210
            :.|                   |.:....:||:.|          |:.||::.         |.|
 Frog   132 SQP-------------------TSQFKAPSKVAAG----------PKTSPLKD---------HPS 158

  Fly   211 PQSAPAWDANNAQQTLPSIPLITDDDDFGLRA------ALHNSGHGNT-SGTAAGQPDFGSTSS- 267
            |:              |.:    ||....|||      .:.:||..:: ||:::|..|..|:|: 
 Frog   159 PE--------------PQL----DDIKRELRAEVEIIEQMSSSGSSSSESGSSSGSDDDSSSSAG 205

  Fly   268 --STHIGKQRQAPPHGHGKRQQMHQRLSPPMAQQQ 300
              .|.....:|.||..:..|..:....|.|....|
 Frog   206 EEETQESPSQQLPPQQYNSRIPVSNGSSRPQGTNQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EafNP_610273.1 EAF 22..122 CDD:286854 48/99 (48%)
eaf1XP_012820413.1 EAF 17..115 CDD:286854 48/98 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6635
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I4785
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002031
OrthoInspector 1 1.000 - - otm49246
Panther 1 1.100 - - O PTHR15970
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4334
SonicParanoid 1 1.000 - - X1502
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.090

Return to query results.
Submit another query.