DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eaf and eaf1

DIOPT Version :9

Sequence 1:NP_610273.1 Gene:Eaf / 35660 FlyBaseID:FBgn0033166 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001343024.1 Gene:eaf1 / 2539104 PomBaseID:SPCC1223.10c Length:251 Species:Schizosaccharomyces pombe


Alignment Length:263 Identity:60/263 - (22%)
Similarity:112/263 - (42%) Gaps:50/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GATFNPKNTSTAFHTIKYDFKPASVDTSRMASVDVGSNNQVTVTVPNSESSGVPHTVYKGN-QRE 89
            |::|: || |....:|||:|.|.|||.||...:: .:.....:.:|::.....|| :::|: ||.
pombe    14 GSSFS-KN-SNGLLSIKYNFIPESVDPSRRGVLE-KAQEAYRLRLPSTFDDDRPH-IFEGSCQRA 74

  Fly    90 YAKECLMIYDKETGAITIEKLNHNIQVKKTRNEVTNKSVQLPGQNMGQPHNQGANGAAPVAVPVP 154
            ...:|::|::.:|...|:|.::...::...||...:|:|  |...:.|..|...:.:...:    
pombe    75 RNVDCVLIFNAKTKTFTLEHIDEIARLNALRNPKVSKTV--PSNAITQSDNSQISESKSTS---- 133

  Fly   155 GQGSGTAPKMENSTMRISTKTKVSTGSRRNNIIDFKPRNSPMQQNSPSRPVPVHRSPQSAPAWDA 219
             |.:.|.    |||.|   |.|....|:...|   ||.:|..:..:.|...|:        ..|.
pombe   134 -QSAVTT----NSTRR---KEKELEASKDGKI---KPSSSNTRYPAISSKGPI--------TTDT 179

  Fly   220 NNAQQTLPSIPLITDDD-----DFGLRAALHNSGHGNTSGTAAGQP-----------DFGSTSSS 268
            |:.    |.:.::..||     :.|.....::....:|....|.:|           |:.|::.:
pombe   180 NDE----PDMEVMELDDFAKELELGFDQEFNSIDDPSTVSQTASKPISLRGLSSQERDYASSAQA 240

  Fly   269 THI 271
            ..|
pombe   241 EGI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EafNP_610273.1 EAF 22..122 CDD:286854 27/96 (28%)
eaf1NP_001343024.1 EAF 9..107 CDD:313104 27/96 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 41 1.000 Domainoid score I3717
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002031
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15970
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.970

Return to query results.
Submit another query.