DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eaf and eaf-1

DIOPT Version :9

Sequence 1:NP_610273.1 Gene:Eaf / 35660 FlyBaseID:FBgn0033166 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001367659.1 Gene:eaf-1 / 172065 WormBaseID:WBGene00017011 Length:251 Species:Caenorhabditis elegans


Alignment Length:259 Identity:67/259 - (25%)
Similarity:120/259 - (46%) Gaps:39/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAERLNIGEEVRELKLGATFNPKNTST-----AFHTIKYDFKPASVDTSRMASVDVGSNNQVTVT 69
            :||..:|......|.||.:|..|...:     .|||::|||||:||..:....:..|::..|.|:
 Worm     1 MAESSDIPNGTYTLTLGKSFEVKGRKSDPKAEQFHTLRYDFKPSSVSNNADTFIAFGNSGDVHVS 65

  Fly    70 VPNSESSGVPHTVYKGNQRE-YAKECLMIYDKETGAITIEKLNHNIQVKKTR--NEVTNKSVQLP 131
            ||   |.|...|||||:::| ..||||:.:||:|..:.:||:..||.|||||  ::.|..:::..
 Worm    66 VP---SEGDNMTVYKGSKKEAKPKECLLFFDKKTNTVRLEKITSNINVKKTRDLDQGTELALKRG 127

  Fly   132 GQNMGQPHNQGANGAAPVAVPVPGQGSGTAPKMENSTMRISTKTKVSTGSRRNN----------- 185
            .:.:....|...:|.:.     |.:.:....:|:..|...|:.:..|:.|.::|           
 Worm   128 IERLRTSSNNQRSGPSS-----PEEKAKIQKQMQRDTSDSSSDSDGSSDSDKSNGDSSDDEDESE 187

  Fly   186 --IIDFKPRNSPMQQNSPSRP--------VPVHRSPQSAPAWDANNAQQTLPSIPL--ITDDDD 237
              :::...:..|..:..|:.|        ...|.:|..:.:.:.|...:....:.|  .:|:||
 Worm   188 KILLEEMKKPKPYTEREPAPPSSSNTYNHKESHVAPYISSSGNKNKDSEEKYGLALSESSDEDD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EafNP_610273.1 EAF 22..122 CDD:286854 44/107 (41%)
eaf-1NP_001367659.1 EAF 12..114 CDD:401683 42/104 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164675
Domainoid 1 1.000 79 1.000 Domainoid score I5667
eggNOG 1 0.900 - - E1_KOG4795
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002031
OrthoInspector 1 1.000 - - oto19337
orthoMCL 1 0.900 - - OOG6_107911
Panther 1 1.100 - - LDO PTHR15970
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4334
SonicParanoid 1 1.000 - - X1502
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.