| Sequence 1: | NP_001097208.1 | Gene: | CG11113 / 35659 | FlyBaseID: | FBgn0033165 | Length: | 138 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001097209.1 | Gene: | CG1701 / 35661 | FlyBaseID: | FBgn0033167 | Length: | 134 | Species: | Drosophila melanogaster |
| Alignment Length: | 134 | Identity: | 52/134 - (38%) |
|---|---|---|---|
| Similarity: | 85/134 - (63%) | Gaps: | 2/134 - (1%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MRRLAVHIAILYLFQWEIGAVLNKI-NELKSWLDQNVKGRQDSDTIDTLIMLCVIEMKEGKKLPA 64
Fly 65 KIANFRITNKNTVQNYIILPTIKIPNITIIFADEKLPVSARSRKQNIEEKLDTLIGFLKDCITKK 129
Fly 130 INLL 133 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45467098 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0016764 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.930 | |||||