DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glo1 and GLO1

DIOPT Version :9

Sequence 1:NP_610270.1 Gene:Glo1 / 35656 FlyBaseID:FBgn0283450 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_013710.1 Gene:GLO1 / 855009 SGDID:S000004463 Length:326 Species:Saccharomyces cerevisiae


Alignment Length:151 Identity:69/151 - (45%)
Similarity:90/151 - (59%) Gaps:3/151 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SSTKDFLFQQTMYRIKDPRKSLPFYTGVLGMTLLVKLDFPEAKFSLYFLGYENATDVPKDPKQRR 85
            |:....|...|..|:|||.:::.|||...||.||.:.||.|||||||||.:.. .|:||: |...
Yeast    16 SNDPTLLLNHTCLRVKDPARTVKFYTEHFGMKLLSRKDFEEAKFSLYFLSFPK-DDIPKN-KNGE 78

  Fly    86 SWALSRKATIELTHNWGTERDPDQNYHTGNTDP-RGFGHIGIMVPDVYAACQRFQELGVDFVKKP 149
            ....|....:|||||||||::||...:.||.:| ||||||...|.|:...|:..:..||.|.|:.
Yeast    79 PDVFSAHGVLELTHNWGTEKNPDYKINNGNEEPHRGFGHICFSVSDINKTCEELESQGVKFKKRL 143

  Fly   150 DDGRMKGLAFIKDPDGYWIEI 170
            .:||.|.:||...|||||||:
Yeast   144 SEGRQKDIAFALGPDGYWIEL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glo1NP_610270.1 Glo_EDI_BRP_like 15..173 CDD:301325 69/151 (46%)
GLO1NP_013710.1 GlxI_Zn 23..165 CDD:319900 67/144 (47%)
GlxI_Zn 183..320 CDD:319900
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 134 1.000 Domainoid score I1100
eggNOG 1 0.900 - - E1_COG0346
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4880
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003357
OrthoInspector 1 1.000 - - oto99237
orthoMCL 1 0.900 - - OOG6_102622
Panther 1 1.100 - - LDO PTHR10374
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R656
SonicParanoid 1 1.000 - - X3241
TreeFam 1 0.960 - -
1110.800

Return to query results.
Submit another query.