DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glo1 and MCEE

DIOPT Version :9

Sequence 1:NP_610270.1 Gene:Glo1 / 35656 FlyBaseID:FBgn0283450 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_115990.3 Gene:MCEE / 84693 HGNCID:16732 Length:176 Species:Homo sapiens


Alignment Length:145 Identity:34/145 - (23%)
Similarity:54/145 - (37%) Gaps:29/145 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IKDPRKSLPFYTGVLGMTLLVKLDFPEAKFSLYFLGYENATDVPKDPKQRRSWALSRKATIELTH 99
            :.|..|:..||..:||..:...:..||...|:.|:...|                   ..:||.|
Human    55 VPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGN-------------------TKMELLH 100

  Fly   100 NWGTERDPDQNYHTGNTDPRGFGHIGIMVPDVYAACQRFQELGV----DFVKKPDDGRMKGLAFI 160
            ..|.: .|...:...| ...|..||.|.|.::.||....::..:    :.||....|  |.:.|:
Human   101 PLGRD-SPIAGFLQKN-KAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHG--KPVIFL 161

  Fly   161 --KDPDGYWIEIFNA 173
              ||..|..:|:..|
Human   162 HPKDCGGVLVELEQA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glo1NP_610270.1 Glo_EDI_BRP_like 15..173 CDD:301325 33/143 (23%)
MCEENP_115990.3 metmalonyl_epim 47..175 CDD:213772 33/142 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0346
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.