DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glo1 and GLYI7

DIOPT Version :10

Sequence 1:NP_610270.1 Gene:Glo1 / 35656 FlyBaseID:FBgn0283450 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001320354.1 Gene:GLYI7 / 844356 AraportID:AT1G80160 Length:208 Species:Arabidopsis thaliana


Alignment Length:142 Identity:32/142 - (22%)
Similarity:56/142 - (39%) Gaps:34/142 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KSLPFYTGVLGMTLLVK---LDFPEAKFSLYFLGYENATDVPKDPKQRRSWALSRKATIELTHNW 101
            :|:.||..|||...:.:   .||..|    :..|:.....:.:.|:..:   |.:|         
plant    67 ESISFYQNVLGFLPIRRPDSFDFDGA----WLFGHGIGIHLLQSPEPEK---LLKK--------- 115

  Fly   102 GTERDPDQNYHTGNTDPRGFGHIGIMVPDVYAACQRFQELGVDFVKK--PDDGRMKGLAFIKDPD 164
             ||.:|..|            ||......:.|..::.:|:.:::|:.  .:.|......|..|||
plant   116 -TEINPKDN------------HISFQCESMEAVEKKLKEMEIEYVRAVVEEGGIQVDQLFFHDPD 167

  Fly   165 GYWIEIFNAHSV 176
            .:.|||.|..|:
plant   168 AFMIEICNCDSL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glo1NP_610270.1 VOC 15..173 CDD:472697 30/137 (22%)
GLYI7NP_001320354.1 VOC_like 55..173 CDD:319909 28/134 (21%)

Return to query results.
Submit another query.