DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glo1 and GLX1

DIOPT Version :9

Sequence 1:NP_610270.1 Gene:Glo1 / 35656 FlyBaseID:FBgn0283450 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001184968.1 Gene:GLX1 / 837731 AraportID:AT1G11840 Length:322 Species:Arabidopsis thaliana


Alignment Length:165 Identity:55/165 - (33%)
Similarity:79/165 - (47%) Gaps:32/165 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AQADELCQKPDSSTKDFLFQQTMYRIKDPRKSLPFYTGVLGMTLLVKLDFPEAKFSLYFLGYENA 74
            |:|.:|.:.|....:.||  ..:||:.|..:::.|||.|.||.||.|.|.||.|:|..|||:...
plant    41 AEASDLLEWPKKDNRRFL--HVVYRVGDLDRTIEFYTEVFGMKLLRKRDIPEEKYSNAFLGFGPE 103

  Fly    75 TDVPKDPKQRRSWALSRKATIELTHNWGTERDPDQNYHTGNTDPRGFGHIGIMVPDVYAACQRFQ 139
            |.               ...:|||:|:|.     .:|..|.    ||||..|...||....:..:
plant   104 TS---------------NFVVELTYNYGV-----SSYDIGT----GFGHFAISTQDVSKLVENVR 144

  Fly   140 ELGVDFVKKPDDGRMKG----LAFIKDPDGYWIEI 170
            ..|.:..::|  |.:||    :||:||||||..|:
plant   145 AKGGNVTREP--GPVKGGGSVIAFVKDPDGYTFEL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glo1NP_610270.1 Glo_EDI_BRP_like 15..173 CDD:301325 53/160 (33%)
GLX1NP_001184968.1 PLN02300 40..322 CDD:215169 55/165 (33%)
glyox_I 40..189 CDD:272886 55/165 (33%)
Glo_EDI_BRP_like 189..316 CDD:301325
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0346
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1513831at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.