DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glo1 and AT2G32090

DIOPT Version :10

Sequence 1:NP_610270.1 Gene:Glo1 / 35656 FlyBaseID:FBgn0283450 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_565737.1 Gene:AT2G32090 / 817769 AraportID:AT2G32090 Length:135 Species:Arabidopsis thaliana


Alignment Length:137 Identity:33/137 - (24%)
Similarity:55/137 - (40%) Gaps:35/137 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FYTGVLGMTLLVKLDFPEAK---------FSLYFLGYENATDVPKDPKQRRSWALSRKATIELTH 99
            ||..|.|...:...||.:.:         |:::.:....:|::|:.|....|             
plant    20 FYKEVFGFEEIESPDFGDLQVVWLNLPGAFAMHIIQRNPSTNLPEGPYSATS------------- 71

  Fly   100 NWGTERDPDQNYHTGNTDPRGFGHIGIMVPDVYAACQRFQELGVD-FVKKPDDGRMKGLAFIKDP 163
               ..:||.   |.    |.|. ||...||:..:.....:|.|:: |.|...||::|.:.|. ||
plant    72 ---AVKDPS---HL----PMGH-HICFSVPNFDSFLHSLKEKGIETFQKSLPDGKVKQVFFF-DP 124

  Fly   164 DGYWIEI 170
            ||..:|:
plant   125 DGNGLEV 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glo1NP_610270.1 VOC 15..173 CDD:472697 33/137 (24%)
AT2G32090NP_565737.1 VOC_like 4..131 CDD:319909 32/135 (24%)

Return to query results.
Submit another query.