DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glo1 and GLYI8

DIOPT Version :9

Sequence 1:NP_610270.1 Gene:Glo1 / 35656 FlyBaseID:FBgn0283450 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_029429.1 Gene:GLYI8 / 817390 AraportID:AT2G28420 Length:184 Species:Arabidopsis thaliana


Alignment Length:168 Identity:47/168 - (27%)
Similarity:69/168 - (41%) Gaps:34/168 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DELCQKPDSSTKDFLFQQTMYRIKDPRKSLPFYTGVLGMTLLVKLDFPEAKFSLYFLGYENATDV 77
            |||..||.....:.:.:    ..||.:|||.|||.|||   .|:::.| |.|.  |.|       
plant    10 DELNSKPPLMALNHVSR----LCKDVKKSLEFYTKVLG---FVEIERP-ASFD--FDG------- 57

  Fly    78 PKDPKQRRSWALSRKATIELTHNWGTERDPDQNYHTGNTDPRGFGHIGIMVPDVYAACQRFQELG 142
                    :|..:....|.|......::.|....|....|    .||.....|:.|..:|.:|:.
plant    58 --------AWLFNYGVGIHLVQAKDQDKLPSDTDHLDPMD----NHISFQCEDMEALEKRLKEVK 110

  Fly   143 VDFVKKPDDGRMKGLA----FIKDPDGYWIEIFNAHSV 176
            |.::|: ..|..|..|    |..||||:.:||.|..::
plant   111 VKYIKR-TVGDEKDAAIDQLFFNDPDGFMVEICNCENL 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glo1NP_610270.1 Glo_EDI_BRP_like 15..173 CDD:301325 44/161 (27%)
GLYI8NP_029429.1 Glo_EDI_BRP_like_9 21..141 CDD:176669 39/149 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.