DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glo1 and glod5

DIOPT Version :9

Sequence 1:NP_610270.1 Gene:Glo1 / 35656 FlyBaseID:FBgn0283450 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001018514.1 Gene:glod5 / 553706 ZFINID:ZDB-GENE-050522-174 Length:163 Species:Danio rerio


Alignment Length:187 Identity:41/187 - (21%)
Similarity:61/187 - (32%) Gaps:67/187 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VTGLSNAQADELCQKPDSSTKDFLFQQTMYRIKDPRKSLPFYTGVLGMTLLV------KLDFPEA 62
            ::|||:.:....|....|.     ....:..::|..|:..||:.||||.::.      .|.|.|.
Zfish    23 LSGLSSVRFRSSCPVLISH-----LDHLVLTVRDLNKTTKFYSEVLGMEVVTFKGDRKALSFGEQ 82

  Fly    63 KFSLYFLGYENATDVPKDPKQRRSWALSRKATIELTHNWGTERDPDQNYHTGNTDPRGFGHIGIM 127
            |.:|                                |..|.|.:|     ...|...|...:.::
Zfish    83 KINL--------------------------------HQVGKEFEP-----KAQTPTPGSADLCLI 110

  Fly   128 -------VPDVYAACQRFQELGVDFVKKPDD-----GRMKGLAFIKDPDGYWIEIFN 172
                   |.|...||      ||...:.|.|     |.:..|.| :|||...||:.|
Zfish   111 TKTPLKAVADHLKAC------GVTIEEGPVDRTGAVGPISSLYF-RDPDDNLIEVSN 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glo1NP_610270.1 Glo_EDI_BRP_like 15..173 CDD:301325 38/176 (22%)
glod5NP_001018514.1 Glo_EDI_BRP_like_2 39..161 CDD:176676 37/171 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0346
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.