DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glo1 and GLOD4

DIOPT Version :10

Sequence 1:NP_610270.1 Gene:Glo1 / 35656 FlyBaseID:FBgn0283450 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001376654.1 Gene:GLOD4 / 51031 HGNCID:14111 Length:364 Species:Homo sapiens


Alignment Length:143 Identity:30/143 - (20%)
Similarity:51/143 - (35%) Gaps:43/143 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IKDPRKSLPFYTGVLGMTLLVKLDFPEAKFSLYFLGYENATDVPKDPKQRRSWA--LSRKATIEL 97
            :.|.:|||.::..:|||.:                 ||      ||.:::|:..  ...:..:||
Human   211 VSDLQKSLNYWCNLLGMKI-----------------YE------KDEEKQRALLGYADNQCKLEL 252

  Fly    98 THNWGTERDPDQNYHTGNTDPRGFGHIGIM-----VPDVYAACQR-FQELGVDFVKKPDDGRMK- 155
                       |....|......||.|...     :||:....:| .|::....|.....|:.. 
Human   253 -----------QGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLVSLDTPGKATV 306

  Fly   156 GLAFIKDPDGYWI 168
            .:..:.||||:.|
Human   307 QVVILADPDGHEI 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glo1NP_610270.1 VOC 15..173 CDD:472697 30/143 (21%)
GLOD4NP_001376654.1 VOC 4..196 CDD:472697
GLOD4_C 206..321 CDD:319964 30/143 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.