DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glo1 and glod4

DIOPT Version :10

Sequence 1:NP_610270.1 Gene:Glo1 / 35656 FlyBaseID:FBgn0283450 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001004613.1 Gene:glod4 / 447874 ZFINID:ZDB-GENE-040912-38 Length:298 Species:Danio rerio


Alignment Length:92 Identity:24/92 - (26%)
Similarity:37/92 - (40%) Gaps:25/92 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 MYRIKDPRKSLPFYTGVLGMTLLVKLDFPEAKFSLYFLGYENATDVPKDPKQRRSWALSRKA--- 93
            ::::.|..|:..||..||||.:|...:|.|        |.:...:.|.|.|    |:.:...   
Zfish    10 VFKVGDRTKTATFYRDVLGMKILRHEEFEE--------GCKATCNGPYDGK----WSKTMVGFGP 62

  Fly    94 -----TIELTHNWGTERDPDQNYHTGN 115
                 ..|||:|:|.     ..|..||
Zfish    63 EDDHFVAELTYNYGV-----GEYRLGN 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glo1NP_610270.1 VOC 15..173 CDD:472697 24/92 (26%)
glod4NP_001004613.1 GLOD4_N 4..130 CDD:319946 24/92 (26%)
GLOD4_C 140..255 CDD:319964
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.