DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glo1 and Glod4

DIOPT Version :9

Sequence 1:NP_610270.1 Gene:Glo1 / 35656 FlyBaseID:FBgn0283450 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001014249.1 Gene:Glod4 / 363644 RGDID:1307010 Length:298 Species:Rattus norvegicus


Alignment Length:92 Identity:22/92 - (23%)
Similarity:40/92 - (43%) Gaps:25/92 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 MYRIKDPRKSLPFYTGVLGMTLLVKLDFPEAKFSLYFLGYENATDVPKDPKQRRSWALSRKA--- 93
            ::::.:..:::.|:..||||.:|...:|.|        |.:.|.:.|.|.|    |:.:...   
  Rat    10 VFKVGNRFQTVHFFRDVLGMQVLRHEEFEE--------GCKAACNGPYDGK----WSKTMVGFGP 62

  Fly    94 -----TIELTHNWGTERDPDQNYHTGN 115
                 ..|||:|:|.     .:|..||
  Rat    63 EDDHFVAELTYNYGI-----GDYKLGN 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glo1NP_610270.1 Glo_EDI_BRP_like 15..173 CDD:301325 22/92 (24%)
Glod4NP_001014249.1 PLN02300 4..264 CDD:215169 22/92 (24%)
Glo_EDI_BRP_like_21 4..130 CDD:176706 22/92 (24%)
Glo_EDI_BRP_like 141..255 CDD:211348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0346
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.