DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glo1 and Mcee

DIOPT Version :9

Sequence 1:NP_610270.1 Gene:Glo1 / 35656 FlyBaseID:FBgn0283450 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_017444518.1 Gene:Mcee / 293829 RGDID:1309966 Length:190 Species:Rattus norvegicus


Alignment Length:150 Identity:34/150 - (22%)
Similarity:56/150 - (37%) Gaps:39/150 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IKDPRKSLPFYTGVLGMTLLVKLDFPEAKFSLYFLGYENATDVPKDPKQRRSWALSRKATIELTH 99
            :.|..|:..||..|||..:...:..||...|:.|:...|                   ..:||.|
  Rat    69 VPDLEKASSFYRDVLGAQVSEAVPLPEHGVSVVFVNLGN-------------------TKMELLH 114

  Fly   100 NWGTERDPDQNYHTGNTDPRGFGHIGIMVPDVYAAC-----QRFQELGVDFVKKPDDGRM----K 155
            ..|:: .|...:...| ...|..|:.|.|.::.||.     |:.:.|.       |:.::    |
  Rat   115 PLGSD-SPIAGFLQKN-KAGGMHHVCIEVDNINAAVMDLKKQKIRSLS-------DEAKIGAHGK 170

  Fly   156 GLAFI--KDPDGYWIEIFNA 173
            .:.|:  ||..|..:|:..|
  Rat   171 PVIFLHPKDCGGVLVELEQA 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glo1NP_610270.1 Glo_EDI_BRP_like 15..173 CDD:301325 33/148 (22%)
MceeXP_017444518.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0346
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.