DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glo1 and GLO1

DIOPT Version :9

Sequence 1:NP_610270.1 Gene:Glo1 / 35656 FlyBaseID:FBgn0283450 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_006699.2 Gene:GLO1 / 2739 HGNCID:4323 Length:184 Species:Homo sapiens


Alignment Length:171 Identity:118/171 - (69%)
Similarity:139/171 - (81%) Gaps:0/171 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GLSNAQADELCQKPDSSTKDFLFQQTMYRIKDPRKSLPFYTGVLGMTLLVKLDFPEAKFSLYFLG 70
            ||::..|...|...|.||||||.||||.|:|||:|||.|||.||||||:.|.|||..|||||||.
Human    10 GLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLA 74

  Fly    71 YENATDVPKDPKQRRSWALSRKATIELTHNWGTERDPDQNYHTGNTDPRGFGHIGIMVPDVYAAC 135
            ||:..|:||:..::.:||||||||:|||||||||.|..|:||.||:||||||||||.|||||:||
Human    75 YEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSAC 139

  Fly   136 QRFQELGVDFVKKPDDGRMKGLAFIKDPDGYWIEIFNAHSV 176
            :||:||||.||||||||:|||||||:|||||||||.|.:.:
Human   140 KRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKM 180

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Glo1NP_610270.1 Glo_EDI_BRP_like 15..173 CDD:301325 114/157 (73%)
GLO1NP_006699.2 VOC 20..183 CDD:326334 115/161 (71%)