DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glo1 and glo1

DIOPT Version :9

Sequence 1:NP_610270.1 Gene:Glo1 / 35656 FlyBaseID:FBgn0283450 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_596010.1 Gene:glo1 / 2539736 PomBaseID:SPBC12C2.12c Length:302 Species:Schizosaccharomyces pombe


Alignment Length:154 Identity:68/154 - (44%)
Similarity:95/154 - (61%) Gaps:13/154 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KPDSSTKDFLFQQTMYRIKDPRKSLPFYTGVLGMTLLVKLDFPEAKFSLYFLGYENATDVPKDPK 82
            ||.::..:|.|..||.|:|||..|:.||. .|||.::.|.|.|..||:.|||.|  .:|:|:.  
pombe   157 KPKANISNFRFNHTMVRVKDPEPSIAFYE-KLGMKVIDKADHPNGKFTNYFLAY--PSDLPRH-- 216

  Fly    83 QRRSWALSRKATIELTHNWGTERDPDQNYHTGNT-DPRGFGHIGIMVPDVYAACQRFQELGVDFV 146
                   .|:..:|||||||||::....||.||. |.:|:||:.|.|.::.|||.:|:..|:.|.
pombe   217 -------DREGLLELTHNWGTEKESGPVYHNGNDGDEKGYGHVCISVDNINAACSKFEAEGLPFK 274

  Fly   147 KKPDDGRMKGLAFIKDPDGYWIEI 170
            ||..|||||.:||:.|||.||:|:
pombe   275 KKLTDGRMKDIAFLLDPDNYWVEV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Glo1NP_610270.1 Glo_EDI_BRP_like 15..173 CDD:301325 68/154 (44%)
glo1NP_596010.1 Glyoxalase_I 12..151 CDD:176659
Glyoxalase_I 167..299 CDD:176659 65/144 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 128 1.000 Domainoid score I1357
eggNOG 1 0.900 - - E1_COG0346
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4880
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003357
OrthoInspector 1 1.000 - - oto100795
orthoMCL 1 0.900 - - OOG6_102622
Panther 1 1.100 - - LDO PTHR10374
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R656
SonicParanoid 1 1.000 - - X3241
TreeFam 1 0.960 - -
1110.800

Return to query results.
Submit another query.