DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Glo1 and Glo1

DIOPT Version :9

Sequence 1:NP_610270.1 Gene:Glo1 / 35656 FlyBaseID:FBgn0283450 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001107032.1 Gene:Glo1 / 109801 MGIID:95742 Length:184 Species:Mus musculus


Alignment Length:172 Identity:120/172 - (69%)
Similarity:140/172 - (81%) Gaps:0/172 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TGLSNAQADELCQKPDSSTKDFLFQQTMYRIKDPRKSLPFYTGVLGMTLLVKLDFPEAKFSLYFL 69
            :||::..|...|..||.||||||.||||.|||||:|||.|||.|||:|||.|||||..|||||||
Mouse     9 SGLTDETAFSCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRVLGLTLLQKLDFPAMKFSLYFL 73

  Fly    70 GYENATDVPKDPKQRRSWALSRKATIELTHNWGTERDPDQNYHTGNTDPRGFGHIGIMVPDVYAA 134
            .||:..|:|||..::.:|..|||||:|||||||||.|..|:||.||:||||||||||.|||||:|
Mouse    74 AYEDKNDIPKDKSEKTAWTFSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSA 138

  Fly   135 CQRFQELGVDFVKKPDDGRMKGLAFIKDPDGYWIEIFNAHSV 176
            |:||:||||.||||||||:|||||||:|||||||||.|.:.:
Mouse   139 CKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKI 180

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Glo1NP_610270.1 Glo_EDI_BRP_like 15..173 CDD:301325 116/157 (74%)
Glo1NP_001107032.1 PLN03042 20..184 CDD:215548 117/161 (73%)