DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr43a and Gr23a

DIOPT Version :9

Sequence 1:NP_001286158.1 Gene:Gr43a / 35655 FlyBaseID:FBgn0041243 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_787965.1 Gene:Gr23a / 33453 FlyBaseID:FBgn0041248 Length:374 Species:Drosophila melanogaster


Alignment Length:171 Identity:41/171 - (23%)
Similarity:81/171 - (47%) Gaps:37/171 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 LKSLADSHESLGKCVHLLSNSFGIAVLFILVSCLLHLVATAYFLFLELLSK--------RDNGYL 353
            :|.|...:..|......::..||.::|.|::......|:.:|:||:::.::        .:.|::
  Fly   210 VKDLKRRYNDLHYLFVRINGYFGGSLLTIIIVHFAIFVSNSYWLFVDIRTRPWRIYAILLNLGFI 274

  Fly   354 W---VQMLWICFHFLRLLMVVEPCHLAARESRKTIQIVCEIER-------KVHEPILAE-AVKKF 407
            :   :||...|:|          |..:....|   ||.|.|.:       |::..:::| :::..
  Fly   275 FNVALQMAAACWH----------CQQSYNLGR---QIGCLISKLVKPQGSKLYNDLVSEFSLQTL 326

  Fly   408 WQQLLVVDADFSACGLCRVNRTILTSFASAIATYLVILIQF 448
            .|:.:|...||.:     :|..:|:|..:|:.|||||||||
  Fly   327 HQRFVVTAKDFFS-----LNLHLLSSMFAAVVTYLVILIQF 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr43aNP_001286158.1 7tm_7 10..449 CDD:285581 41/171 (24%)
Gr23aNP_787965.1 7tm_7 <141..362 CDD:285581 39/169 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.