DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr43a and Gr59a

DIOPT Version :9

Sequence 1:NP_001286158.1 Gene:Gr43a / 35655 FlyBaseID:FBgn0041243 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster


Alignment Length:371 Identity:68/371 - (18%)
Similarity:123/371 - (33%) Gaps:124/371 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 YSLYFILTGLQVNIANTAY-GLGRRF--GRLNR------------MLSSSFLAENNATSA----- 227
            |::|.:..|:      |:| .:|.:|  .|:.|            :|.|:|.......|.     
  Fly     8 YNVYAVFIGM------TSYETMGGKFRQSRITRIYCLLINAIFLTLLPSAFWKSAKLLSTADWMP 66

  Fly   228 ----IKPQKVSTVKNVSV--------NRPAMPSALHASLTKLNGETLPSEAAGDKAAARSLILNV 280
                :.|..:.|:...::        .|.||...|...:.::|.|.|   ..|.|  ..||:..:
  Fly    67 SYMRVTPYIMCTINYAAIAYTLISRCYRDAMLMDLQRIVLEVNREML---RTGKK--MNSLLRRM 126

  Fly   281 ELLK--------LGYFPAKNKGLLLKSLADSHESLGKCVHLLSNSFGIAVLFI------------ 325
            ..||        |.|..|.   .:.:..|.:..:|  |..||.| ..:.:||:            
  Fly   127 FFLKTFTLTYSCLSYILAV---FIYQWKAQNWSNL--CNGLLVN-ISLTILFVNTFFYFTSLWHI 185

  Fly   326 -----LVSCLLHLVATAYFLFLELLSKRDNGYLWV------------------QMLWICFHFLRL 367
                 .|:..|:.:.....:.||..||...| ||.                  |||.:.|.:. :
  Fly   186 ARGYDFVNQQLNEIVACQSMDLERKSKELRG-LWALHRNLSYTARRINKHYGPQMLAMRFDYF-I 248

  Fly   368 LMVVEPC---HLAARESRKTIQ-------------------IVCEI--ERKVHEPILA--EAVKK 406
            ..::..|   ..:..:...:::                   .:|::  |.::.....|  .::..
  Fly   249 FSIINACIGTIYSTTDQEPSLEKIFGSLIYWVRSFDFFLNDYICDLVSEYQMQPKFFAPESSMSN 313

  Fly   407 FWQQLLVVDA----DFSACGLCRVNRTILTSFASAIATYLVILIQF 448
            .....|:.::    |...|||.|||:........:|..:..:|.||
  Fly   314 ELSSYLIYESSTRLDLLVCGLYRVNKRKWLQMVGSIVVHSSMLFQF 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr43aNP_001286158.1 7tm_7 10..449 CDD:285581 68/371 (18%)
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 68/371 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.