DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr43a and Gr98c

DIOPT Version :9

Sequence 1:NP_001286158.1 Gene:Gr43a / 35655 FlyBaseID:FBgn0041243 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_524531.2 Gene:Gr98c / 117336 FlyBaseID:FBgn0046886 Length:408 Species:Drosophila melanogaster


Alignment Length:336 Identity:66/336 - (19%)
Similarity:120/336 - (35%) Gaps:116/336 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 IGRSWLFTVYS-ATLTVVMVFLTY--RGLLFD--ANSEIPVRA------------SFRMKSATS- 80
            :||:..|.:.: ||...:.:.|.|  .||::|  ||.::.:..            |||::...| 
  Fly    87 MGRTQKFLIVAIATCNQLNILLNYGRLGLIYDEIANLDLGIDKSSKNFCGKSHWWSFRLRLTLSI 151

  Fly    81 ---------------------------KVVTALDVSVVVMAIVSG-VYCGLFSLNDTLELNDR-- 115
                                       :|:|.:   :::|..:.| .||....|...|.|..|  
  Fly   152 GLWMVIIIGVIPRLTLGRAGPFFHWVNQVLTQI---ILIMLQLKGPEYCLFVLLVYELILRTRHV 213

  Fly   116 LNKIDNTLNAYNNFRRDRWRALGMAAVSLLAISILVGL------DVGTWMRIAQDMNIAQSDTEL 174
            |.::.:.|..:     |....:....|:|....:|:|.      ::|.:.|              
  Fly   214 LEQLKDDLEDF-----DCGARIQELCVTLKQNQLLIGRIWRLVDEIGAYFR-------------- 259

  Fly   175 NVHWYIPFYSLYFILTGLQV-NIANTAYGLGRRFG-----RLNRMLSSSFLAEN-NATSAIKPQK 232
               |.:   :|.|:..||.: ::.|  :.:.|...     :|||:.|.:||:.| ..|.......
  Fly   260 ---WSM---TLLFLYNGLTILHVVN--WAIIRSIDPNDCCQLNRLGSITFLSFNLLLTCFFSECC 316

  Fly   233 VSTVKNVSV---NRPAMPSALHASLTKLNGETLPSEAAGDKAAARSLILNVELLKL-----GYFP 289
            |.|..::|.   ....:|:|....:.|:              ..:..||.::.|||     |.|.
  Fly   317 VKTYNSISYILHQIGCLPTAEEFQMLKM--------------GLKEYILQMQHLKLLFTCGGLFD 367

  Fly   290 AKNK---GLLL 297
            ...|   |:|:
  Fly   368 INIKLFGGMLV 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr43aNP_001286158.1 7tm_7 10..449 CDD:285581 66/336 (20%)
Gr98cNP_524531.2 7tm_7 15..393 CDD:285581 66/336 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.