DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr43a and Gr98b

DIOPT Version :9

Sequence 1:NP_001286158.1 Gene:Gr43a / 35655 FlyBaseID:FBgn0041243 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_733213.1 Gene:Gr98b / 117327 FlyBaseID:FBgn0046887 Length:403 Species:Drosophila melanogaster


Alignment Length:137 Identity:30/137 - (21%)
Similarity:54/137 - (39%) Gaps:35/137 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 LLHLVATAYFLFLELLSKRDNGYLWVQMLWICFHFLRLLM-------VVEPCHLAARESRKTIQI 387
            :||:|..||.          |.:|:..    |..:.|.|:       ::.||.|    |::.|..
  Fly   271 ILHMVNWAYI----------NKFLYDS----CCQYERFLVCSTLLVNLLLPCLL----SQRCINA 317

  Fly   388 VCEIERKVHE----------PILAEAVKKFWQQLLVVDADFSACGLCRVNRTILTSFASAIATYL 442
            .....|.:|:          .:|...::::..|:..:...|:..||..:|..........|..|:
  Fly   318 YNCFPRILHKIRCTSADPNFAMLTRGLREYSLQMEHLKLRFTCGGLFDINLKYFGGLLVTIFGYI 382

  Fly   443 VILIQFQ 449
            :|||||:
  Fly   383 IILIQFK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr43aNP_001286158.1 7tm_7 10..449 CDD:285581 29/135 (21%)
Gr98bNP_733213.1 7tm_7 13..391 CDD:285581 30/137 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.