DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhx15 and AT5G14900

DIOPT Version :9

Sequence 1:NP_001260766.1 Gene:Dhx15 / 35654 FlyBaseID:FBgn0033160 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_196994.1 Gene:AT5G14900 / 831342 AraportID:AT5G14900 Length:301 Species:Arabidopsis thaliana


Alignment Length:293 Identity:187/293 - (63%)
Similarity:228/293 - (77%) Gaps:11/293 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   438 SNLGTVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALDDDGNLTDLGAVMSEFPLDP 502
            :||...||.||.|.:.:||.||.:|.|||:||.|||:.|.:|.|||||.|||..|.:||||||||
plant     2 TNLANTVLTLKGLSVKNLVRFDLIDSPAPDTLARALDDLYHLGALDDDCNLTKTGEMMSEFPLDP 66

  Fly   503 QLAKMLIASCQHNCSNEILSITAMLSVPQCFVRP-NEAKKAADEAKMRFAHIDGDHLTLLNVYHA 566
            |:|||||.|.|.|||||||||:||||||.||:|| .||:|||||||..|||||||||||||::||
plant    67 QMAKMLIVSPQFNCSNEILSISAMLSVPNCFIRPRGEAQKAADEAKSSFAHIDGDHLTLLNLFHA 131

  Fly   567 FKQSSEDPNWCYENFINFRSLKSADNVRQQLARIMDRFNLRRTSTEFTSKDYYVNIRKALVQGFF 631
            |.|:::|||||...|||:|::|||.:||:||.|||.||.::..|.:|.|:||||||||||:.|:|
plant   132 FLQNNQDPNWCCTKFINYRAMKSAVSVREQLVRIMLRFQIKLCSPDFNSRDYYVNIRKALLAGYF 196

  Fly   632 MQVAHLERTGYYLTI--KDNQNVQLHPSTCLDHKPDWVIYNEFVLTTKNYIRTVTDVKPEWLCCL 694
            ||||||||||:|||.  ||:|.|.||||.||||||:||:|||:|.|::|:|||||.::.|||..:
plant   197 MQVAHLERTGHYLTFRDKDDQVVHLHPSNCLDHKPEWVVYNEYVFTSRNFIRTVTHIRGEWLVDV 261

  Fly   695 APQYYDLNNFPQCEAKRQLELLQQRLETKQYQK 727
            ||.||.|.|||..||||.||        :.|:|
plant   262 APHYYKLANFPSSEAKRVLE--------RHYKK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dhx15NP_001260766.1 Motor_domain 50..>102 CDD:277568
DEXDc 67..255 CDD:214692
DEXDc 91..228 CDD:238005
HELICc 315..408 CDD:197757
HA2 478..561 CDD:214852 64/83 (77%)
OB_NTP_bind 595..698 CDD:285018 67/104 (64%)
AT5G14900NP_196994.1 HrpA <2..292 CDD:224557 187/293 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 146 1.000 Domainoid score I1462
eggNOG 1 0.900 - - E1_COG1643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000059
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.