DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhx15 and Zcchc17

DIOPT Version :9

Sequence 1:NP_001260766.1 Gene:Dhx15 / 35654 FlyBaseID:FBgn0033160 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_694800.1 Gene:Zcchc17 / 619605 MGIID:1919955 Length:241 Species:Mus musculus


Alignment Length:157 Identity:36/157 - (22%)
Similarity:59/157 - (37%) Gaps:34/157 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 GELKCIPLYSTLPPNLQQRIFEPAPPPNANGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAK-- 376
            ||:..:..|..         |...|.....|.:.|..:.|..:.:.|..:|    |.|..:.|  
Mouse    21 GEVAMVTDYGA---------FIKIPGCRKQGLVHRTHMSSCRVDKPSEIVD----VGDKVWVKLI 72

  Fly   377 -QKVYNPRIRVESLLVSPISKASAQQRSGRAGRTRPGKCFRLYTEKAFKNEMQDNTYPEI-LRSN 439
             :::.|.||:| ||.:..:::.:        |:........:..|:..:...||.|..:| |.:.
Mouse    73 GREMKNDRIKV-SLSMKVVNQGT--------GKDLDPNNVVIEQEERRRRSFQDYTGQKITLEAV 128

  Fly   440 LGTVVLQLKKLGIDDLVHFD---FMDP 463
            |.|.   .||.|...  ||.   ||.|
Mouse   129 LNTT---CKKCGCKG--HFAKDCFMQP 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dhx15NP_001260766.1 Motor_domain 50..>102 CDD:277568
DEXDc 67..255 CDD:214692
DEXDc 91..228 CDD:238005
HELICc 315..408 CDD:197757 18/95 (19%)
HA2 478..561 CDD:214852
OB_NTP_bind 595..698 CDD:285018
Zcchc17NP_694800.1 S1_pNO40 13..86 CDD:240191 18/78 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..241
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.