DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Dhx15 and ZCCHC17

DIOPT Version :9

Sequence 1:	NP_001260766.1	Gene:	Dhx15 / 35654	FlyBaseID:	FBgn0033160	Length:	729	Species:	Drosophila melanogaster
Sequence 2:	NP_001269495.1	Gene:	ZCCHC17 / 51538	HGNCID:	30246	Length:	263	Species:	Homo sapiens

Alignment Length:	137	Identity:	33/137 - (24%)
Similarity:	54/137 - (39%)	Gaps:	25/137 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   334 FEPAPPPNANGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAK---QKVYNPRIRVESLLVSPIS 395
            |...|.....|.:.|..:.|..:.:.|..:|    |.|..:.|   :::.|.||:| ||.:..::
Human    54 FIKIPGCRKQGLVHRTHMSSCRVDKPSEIVD----VGDKVWVKLIGREMKNDRIKV-SLSMKVVN 113

  Fly   396 KASAQQRSGRAGRTRPGKCFRLYTEKAFKNEMQDNTYPEI-LRSNLGTVVLQLKKLGIDDLVHFD 459
            :.:.:...       |.... :..|:..:...||.|..:| |.:.|.|.   .||.|...  ||.
Human   114 QGTGKDLD-------PNNVI-IEQEERRRRSFQDYTGQKITLEAVLNTT---CKKCGCKG--HFA 165

  Fly   460 ---FMDP 463
               ||.|
Human   166 KDCFMQP 172

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Dhx15	NP_001260766.1	Motor_domain	50..>102	CDD:277568
		DEXDc	67..255	CDD:214692
		DEXDc	91..228	CDD:238005
		HELICc	315..408	CDD:197757	16/76 (21%)
		HA2	478..561	CDD:214852
		OB_NTP_bind	595..698	CDD:285018
ZCCHC17	NP_001269495.1	S1_pNO40	45..108	CDD:240191	15/58 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1643
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900