DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhx15 and Y108F1.5

DIOPT Version :9

Sequence 1:NP_001260766.1 Gene:Dhx15 / 35654 FlyBaseID:FBgn0033160 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001361911.1 Gene:Y108F1.5 / 353490 WormBaseID:WBGene00022433 Length:147 Species:Caenorhabditis elegans


Alignment Length:144 Identity:55/144 - (38%)
Similarity:88/144 - (61%) Gaps:1/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   469 LMRALELLNYLAALDDDGNLTD-LGAVMSEFPLDPQLAKMLIASCQHNCSNEILSITAMLSVPQC 532
            ::..||||..|.|:|:...||. ||..|:||||.|..:|.|:.|.:..|..|:::|.||:.:...
 Worm     1 MINGLELLYALGAIDETSQLTSPLGLQMAEFPLPPMHSKCLLKSAEFGCFTEMVTIVAMMQIQDV 65

  Fly   533 FVRPNEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQSSEDPNWCYENFINFRSLKSADNVRQQL 597
            |:.|...:..||..:.:||..:|:|:|:|||:..|.::.....||.::|:|:|.|..|||||.||
 Worm    66 FITPYRQRHQADVIRKKFAVEEGNHITMLNVFTKFVENGRSKKWCSDHFVNYRGLMRADNVRSQL 130

  Fly   598 ARIMDRFNLRRTST 611
            .|::.||.:.:.|:
 Worm   131 VRLLKRFEIEKVSS 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dhx15NP_001260766.1 Motor_domain 50..>102 CDD:277568
DEXDc 67..255 CDD:214692
DEXDc 91..228 CDD:238005
HELICc 315..408 CDD:197757
HA2 478..561 CDD:214852 30/83 (36%)
OB_NTP_bind 595..698 CDD:285018 6/17 (35%)
Y108F1.5NP_001361911.1 HrpA <1..>144 CDD:224557 54/142 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1643
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000059
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.