DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cos and AT1G20060

DIOPT Version :10

Sequence 1:NP_477092.1 Gene:cos / 35653 FlyBaseID:FBgn0000352 Length:1201 Species:Drosophila melanogaster
Sequence 2:NP_173434.4 Gene:AT1G20060 / 838594 AraportID:AT1G20060 Length:970 Species:Arabidopsis thaliana


Alignment Length:38 Identity:11/38 - (28%)
Similarity:14/38 - (36%) Gaps:10/38 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LQRRFCLLLVGAACLVLLVSLHVDVVQTASIYAPDFND 40
            |:....|:.|||...:||          .....|.|||
plant   160 LEAELILVFVGALMSMLL----------GCEMEPVFND 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cosNP_477092.1 Kinesin 140..389 CDD:459720
SMC_N 660..>999 CDD:481474
AT1G20060NP_173434.4 Motor_domain 123..>360 CDD:473979 11/38 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.