DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cos and Klp59C

DIOPT Version :9

Sequence 1:NP_001260765.1 Gene:cos / 35653 FlyBaseID:FBgn0000352 Length:1201 Species:Drosophila melanogaster
Sequence 2:NP_611759.1 Gene:Klp59C / 37671 FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster


Alignment Length:528 Identity:118/528 - (22%)
Similarity:196/528 - (37%) Gaps:138/528 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EIPIQVAVRIFPHRELKDLLRSFG----------PTEPKKDAQAVDEGADSKDSEAQVPAAEKDN 56
            |:|:::.|.:.||  :.|..|..|          ...|:...|.:..|:.| ...|..|..::..
  Fly    49 ELPLELVVLMNPH--IFDSPRCSGGNAASANQTASISPRSMKQRIATGSLS-PVLATAPPRQQTA 110

  Fly    57 PSISETDPNGNA-------EQDSAADSKTIPD---ANGNDSG------------QKDYPDS---- 95
            |.:.|.:....|       |:...|.::|..|   ....|.|            |::..:|    
  Fly   111 PPVREDEVVHQAERMRKERERRREAQARTRLDREQGKNEDPGNPNWEVARMIRLQREQMESQRVR 175

  Fly    96 -------------AYCVQAIPISASAL--------GLPS--ALPGGDPMDSIAAGLIQ-VGPHTV 136
                         ..||:..|:....|        .:||  .|...:|...:  .|:: :..|:.
  Fly   176 SGTTNERINCHQIMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHEPRKHV--NLVKFLENHSF 238

  Fly   137 PVTHALPSSSSQEQVYHQTVFPLITLFLEGFDASVVTYGQRGQGKSYTLYGNVQDPTLTDST-EG 200
            ...:......|...||..|..|||....:|..|:...|||.|.||:||:.|  |.|....|: :|
  Fly   239 RFDYVFDEECSNATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGG--QFPGRHQSSMDG 301

  Fly   201 VVQLCVRDIFSHISLHPERTYAINV--GFVEICGGDVCDLL--------------------GMGN 243
            :..:..:|:||.:...|.....:.|  .|.||.|..|.|||                    |:..
  Fly   302 IYAMAAKDVFSTLKTVPYNKLNLKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDRNQQVQVVGLTQ 366

  Fly   244 IHCTNVDAVFHWLQVGLSAR---------QSLPAHTLFTLTLEQQWVSKEGLLQHRLSTASFSDL 299
            ....|...|...|::|.|.|         :|..:|.:|.:.|.    |..|...|  ...|..||
  Fly   367 NPVQNTAEVLDLLELGNSVRTSGHTSANSKSSRSHAVFQIVLR----SAAGEKLH--GKFSLIDL 425

  Fly   300 CGTERCGDQP--------PGRPLDAGLCMLEQVISTLTDPGLMYGVNGNIPYGQTTLTTLLKDSF 356
            .|.||..|..        .|..::..|.:|::.|..|...      :.::|:..:.||.:|:|||
  Fly   426 AGNERGADNSSADRQTRLEGSEINKSLLVLKECIRALGRQ------SSHLPFRGSKLTQVLRDSF 484

  Fly   357 --GGRAQTLVILCVSPLEEHLPETLGNLQFAFKVQCVRNFVIMNTYSDDNTMIVQ--PAEPVPES 417
              |.:.:|.:|..:||....:..||..|::|.:|:               .:.|:  |::.:|::
  Fly   485 IGGKKVKTCMIAMISPCLHSVEHTLNTLRYADRVK---------------ELSVESIPSKRMPDA 534

  Fly   418 NSSAGPLS 425
            |..:..:|
  Fly   535 NLGSTSMS 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cosNP_001260765.1 Motor_domain 132..389 CDD:277568 78/298 (26%)
SPEC 657..856 CDD:295325
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 87/347 (25%)
Kinesin 193..520 CDD:278646 86/357 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437789
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.