DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and Kirrel3

DIOPT Version :10

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:NP_001420714.1 Gene:Kirrel3 / 67703 MGIID:1914953 Length:803 Species:Mus musculus


Alignment Length:717 Identity:163/717 - (22%)
Similarity:257/717 - (35%) Gaps:167/717 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   440 QEETMEPGPSVFLKCVAGGNPTPE----ISWELDGKKI-ANNDRYQVGQYVTVNGDVVS---YLN 496
            |::.:..|..|.|.|.     .||    :.|..||..: ...|.....||:.| |:.:|   :|.
Mouse    55 QDQVVVSGQPVTLLCA-----IPEYDGFVLWIKDGLALGVGRDLSSYPQYLVV-GNHLSGEHHLK 113

  Fly   497 ITSVHANDGGLYKCIAKSKVGVAEHSAKLNV---------YGLPYIRQMEKKAIVAGETLIVTCP 552
            |......|..:|:|.| .:..:....|:|.|         .|.|.|      ::.||:.|.:||.
Mouse   114 ILRAELQDDAVYECQA-IQAAIRSRPARLTVLVPPDDPIILGGPVI------SLRAGDPLNLTCH 171

  Fly   553 V-AGYPIDSIVWERDNRA----------LPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQE 606
            . ...|..||:|.|....          |...:::.:.  .||.|...:..:.| :..|.|.|: 
Mouse   172 ADNAKPAASIIWLRKGEVINGATYSKTLLRDGKRESIV--STLFISPGDVENGQ-SIVCRATNK- 232

  Fly   607 GYSARGSLEVQVMV---LPQIVPFAYEDLINMGDSIDLF-CQIQKGDRPIKVHWS---------- 657
              :..|..|..|.:   .|.:|..:.|....:.|:|..| |..:......:..|:          
Mouse   233 --AIPGGKETSVTIDIQHPPLVNLSVEPQPVLEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEAS 295

  Fly   658 --FERSAGDYGFDQVQPQMRTNRISEKTSMISIPSASPAHTGRDTCIASNKAGTTTYSVDLTVNV 720
              ..|:..||.:           .||..|                |..:|..|:|..|..:.|..
Mouse   296 GELYRTTVDYTY-----------FSEPVS----------------CEVTNALGSTNLSRTVDVYF 333

  Fly   721 PPRWILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVD 785
            .||...||.......||||...|...|.|...:.|.|            :.|..:...|.||.:.
Mouse   334 GPRMTSEPQSLLVDLGSDAVFSCAWIGNPSLTIVWMK------------RGSGVVLSNEKTLTLK 386

  Fly   786 NIQKTNEGYYLCEA-INGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIG 849
            ::::.:.|.|:|.| :..:|:| ...:.::|..|| .....:.|.|..||...::|..:...|..
Mouse   387 SVRQEDAGKYVCRAVVPRVGAG-EREVTLTVNGPP-IISSTQTQHALHGEKGQIKCFIRSTPPPD 449

  Fly   850 -ILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSD-SALFTCVATNAFGSDDASINM 912
             |.|:.....|:.....|||:.......||:|:|:|....|:| ..::.|.|.|:||||...|.:
Mouse   450 RIAWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRL 514

  Fly   913 IVQ----------EVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWSEIDR 967
            ..|          |...:|.|:.:....|..|..         ..|...|:.|..:|:..|...|
Mouse   515 KEQGSEMKSGAGLEAESVPMAVIIGVAVGAGVAF---------LVLMATIVAFCCARSQRSTGGR 570

  Fly   968 VIVPGHTTEAQVQKLSPATTYNIR--IVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPVNQ 1030
            ..:.|..||.:.:...|... |::  :.|:|.|...        |..:|..||:      |..:.
Mouse   571 PGISGRGTEKKARLRLPRRA-NLKGVVSAKNDIRVE--------IVHKEPSSGR------EAEDH 620

  Fly  1031 TTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLRVYTQ--Y 1093
            ||::.....      .||.            ....|.:.:..:.||.|    |.|||:..|.  |
Mouse   621 TTIKQLMMD------RGEF------------QQDSVLKQLEVLKEEEK----EFQNLKDPTNGYY 663

  Fly  1094 SV 1095
            ||
Mouse   664 SV 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 IgI_1_Dscam 38..136 CDD:409547
Ig strand A 39..42 CDD:409547
Ig strand A' 48..52 CDD:409547
Ig strand B 55..64 CDD:409547
Ig strand C 70..76 CDD:409547
Ig strand C' 78..81 CDD:409547
Ig strand D 87..90 CDD:409547
Ig strand E 95..100 CDD:409547
Ig strand F 113..121 CDD:409547
Ig strand G 124..136 CDD:409547
IgI_2_Dscam 246..343 CDD:409545
Ig strand A 247..250 CDD:409545
Ig strand A' 260..264 CDD:409545
Ig strand B 267..274 CDD:409545
Ig strand C 282..288 CDD:409545
Ig strand C' 294..297 CDD:409545
Ig strand D 303..307 CDD:409545
Ig strand E 309..315 CDD:409545
Ig strand F 322..330 CDD:409545
Ig strand G 333..343 CDD:409545
IgC2_3_Dscam 346..426 CDD:409549
Ig strand A 347..352 CDD:409549
Ig strand A' 355..359 CDD:409549
Ig strand B 362..372 CDD:409549
Ig strand C 377..383 CDD:409549
Ig strand C' 384..387 CDD:409549
Ig strand E 392..398 CDD:409549
Ig strand F 405..413 CDD:409549
Ig strand G 416..426 CDD:409549
IgI_4_Dscam 432..527 CDD:409548 24/94 (26%)
Ig strand A 432..435 CDD:409548
Ig strand A' 441..445 CDD:409548 0/3 (0%)
Ig strand B 448..457 CDD:409548 3/8 (38%)
Ig strand C 462..468 CDD:409548 3/9 (33%)
Ig strand C' 470..473 CDD:409548 1/2 (50%)
Ig strand D 478..486 CDD:409548 2/7 (29%)
Ig strand E 490..499 CDD:409548 3/11 (27%)
Ig strand F 506..514 CDD:409548 3/7 (43%)
Ig strand G 517..527 CDD:409548 2/9 (22%)
IgI_5_Dscam 531..618 CDD:409550 22/97 (23%)
Ig strand A 531..533 CDD:409550 1/1 (100%)
Ig strand A' 538..542 CDD:409550 0/3 (0%)
Ig strand B 545..552 CDD:409550 2/6 (33%)
Ig strand C 559..565 CDD:409550 3/5 (60%)
Ig strand C' 566..568 CDD:409550 0/1 (0%)
Ig strand D 575..579 CDD:409550 0/3 (0%)
Ig strand E 582..588 CDD:409550 3/5 (60%)
Ig strand F 596..604 CDD:409550 2/7 (29%)
Ig strand G 608..618 CDD:409550 2/9 (22%)
Ig 621..718 CDD:472250 19/109 (17%)
Ig strand B 639..643 CDD:409353 2/4 (50%)
Ig strand C 653..657 CDD:409353 0/3 (0%)
Ig strand E 684..688 CDD:409353 1/3 (33%)
Ig strand F 698..703 CDD:409353 1/4 (25%)
Ig strand G 711..714 CDD:409353 0/2 (0%)
IgI_7_Dscam 721..815 CDD:409546 23/94 (24%)
Ig strand A 721..725 CDD:409546 2/3 (67%)
Ig strand A' 730..734 CDD:409546 0/3 (0%)
Ig strand B 737..746 CDD:409546 4/8 (50%)
Ig strand C 752..758 CDD:409546 1/5 (20%)
Ig strand C' 764..767 CDD:409546 0/2 (0%)
Ig strand D 775..778 CDD:409546 0/2 (0%)
Ig strand E 780..786 CDD:409546 2/5 (40%)
Ig strand F 793..801 CDD:409546 4/8 (50%)
Ig strand G 806..815 CDD:409546 1/8 (13%)
Ig 818..916 CDD:472250 30/109 (28%)
Ig strand B 836..840 CDD:409353 0/3 (0%)
Ig strand C 849..853 CDD:409353 1/4 (25%)
Ig strand E 880..884 CDD:409353 2/3 (67%)
Ig strand F 894..899 CDD:409353 1/4 (25%)
FN3 <899..1212 CDD:442628 48/211 (23%)
Ig strand G 907..910 CDD:409353 0/2 (0%)
FN3 1222..1312 CDD:238020
Ig <1339..1406 CDD:472250
Ig strand C 1350..1354 CDD:409358
Ig strand E 1372..1376 CDD:409358
Ig strand F 1386..1391 CDD:409358
Ig strand G 1399..1402 CDD:409358
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1893..2008 CDD:463546
Kirrel3NP_001420714.1 IG_like 54..143 CDD:214653 24/94 (26%)
Ig strand B 65..69 CDD:409390 2/3 (67%)
Ig strand C 73..81 CDD:409390 1/7 (14%)
Ig strand E 110..114 CDD:409390 1/3 (33%)
Ig strand F 124..129 CDD:409390 2/4 (50%)
Ig strand G 135..139 CDD:409390 0/3 (0%)
IgI_2_KIRREL3-like 149..246 CDD:409416 24/108 (22%)
Ig strand A 150..153 CDD:409416 0/2 (0%)
Ig strand A' 156..160 CDD:409416 2/9 (22%)
Ig strand B 167..174 CDD:409416 2/6 (33%)
Ig strand C 179..184 CDD:409416 2/4 (50%)
Ig strand C' 187..189 CDD:409416 0/1 (0%)
Ig strand D 192..199 CDD:409416 0/6 (0%)
Ig strand E 206..214 CDD:409416 2/9 (22%)
Ig strand F 223..231 CDD:409416 3/8 (38%)
Ig strand G 237..243 CDD:409416 1/5 (20%)
Ig <267..334 CDD:472250 15/93 (16%)
Ig strand B 267..271 CDD:409437 1/3 (33%)
Ig strand C 280..285 CDD:409437 0/4 (0%)
Ig strand E 304..308 CDD:409437 2/14 (14%)
Ig strand G 326..329 CDD:409437 1/2 (50%)
Ig 335..416 CDD:472250 23/93 (25%)
Ig strand B 352..356 CDD:409549 1/3 (33%)
Ig strand C 365..369 CDD:409549 0/3 (0%)
Ig strand E 381..385 CDD:409549 2/3 (67%)
IgI_5_KIRREL3 418..515 CDD:409479 29/97 (30%)
Ig strand A 419..423 CDD:409479 2/4 (50%)
Ig strand A' 425..428 CDD:409479 0/2 (0%)
Ig strand B 436..443 CDD:409479 1/6 (17%)
Ig strand C 450..455 CDD:409479 2/4 (50%)
Ig strand C' 457..460 CDD:409479 0/2 (0%)
Ig strand D 468..475 CDD:409479 2/6 (33%)
Ig strand E 478..485 CDD:409479 4/6 (67%)
Ig strand F 496..503 CDD:409479 2/6 (33%)
Ig strand G 506..513 CDD:409479 3/6 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.