Sequence 1: | NP_001246162.1 | Gene: | Dscam1 / 35652 | FlyBaseID: | FBgn0033159 | Length: | 2038 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
Alignment Length: | 210 | Identity: | 52/210 - (24%) |
---|---|---|---|
Similarity: | 90/210 - (42%) | Gaps: | 10/210 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 716 LTVNVPPRWILE----PTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIR 776
Fly 777 VEEGTLHVDNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCE 841
Fly 842 AKGEKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSD 906
Fly 907 DASINMIVQEVPEMP 921 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dscam1 | NP_001246162.1 | Ig | 38..130 | CDD:299845 | |
IG | 57..133 | CDD:214652 | |||
IG_like | 267..343 | CDD:214653 | |||
Ig | 269..340 | CDD:143165 | |||
IG_like | 353..425 | CDD:214653 | |||
IGc2 | 361..413 | CDD:197706 | |||
I-set | 433..527 | CDD:254352 | |||
IGc2 | 446..517 | CDD:197706 | |||
I-set | 533..618 | CDD:254352 | |||
IGc2 | 544..607 | CDD:197706 | |||
Ig | 641..714 | CDD:143165 | |||
IGc2 | 735..804 | CDD:197706 | 20/68 (29%) | ||
I-set | 819..914 | CDD:254352 | 18/94 (19%) | ||
Ig | 833..921 | CDD:299845 | 17/87 (20%) | ||
FN3 | 918..1011 | CDD:238020 | 2/4 (50%) | ||
FN3 | 1018..1116 | CDD:238020 | |||
FN3 | 1124..1217 | CDD:238020 | |||
FN3 | 1222..1312 | CDD:238020 | |||
Ig | 1339..1406 | CDD:299845 | |||
FN3 | 1409..1499 | CDD:238020 | |||
FN3 | 1504..1584 | CDD:238020 | |||
Dscam_C | 1890..2008 | CDD:289151 | |||
DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 2/3 (67%) |
Ig | 145..238 | CDD:416386 | 27/96 (28%) | ||
Ig strand A | 145..149 | CDD:409353 | 2/4 (50%) | ||
Ig strand A' | 154..159 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 165..172 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 178..183 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 185..187 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 195..199 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 203..209 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 216..223 | CDD:409353 | 4/6 (67%) | ||
Ig strand G | 230..238 | CDD:409353 | 2/7 (29%) | ||
Ig | 242..333 | CDD:416386 | 18/92 (20%) | ||
Ig strand A' | 250..253 | CDD:409353 | 0/2 (0%) | ||
Ig strand B | 259..266 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 272..277 | CDD:409353 | 2/4 (50%) | ||
Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 289..293 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 295..305 | CDD:409353 | 2/11 (18%) | ||
Ig strand F | 314..322 | CDD:409353 | 1/7 (14%) | ||
Ig strand G | 325..334 | CDD:409353 | 3/8 (38%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |