DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and nrcama

DIOPT Version :10

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:XP_005164693.1 Gene:nrcama / 556537 ZFINID:ZDB-GENE-041210-235 Length:1324 Species:Danio rerio


Alignment Length:1669 Identity:352/1669 - (21%)
Similarity:568/1669 - (34%) Gaps:534/1669 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PPDADQKGPV-FLKEPTNRIDFSNSTGAEIECKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDG 94
            ||....:.|. ::.:|...|:        |.|:|.|.|.|...|.| :||..       .:..|.
Zfish    45 PPTITNQSPKDYIIDPRENIN--------IFCEAKGKPHPSFSWTR-NGTHF-------DVEKDP 93

  Fly    95 KLVFPP------FRAEDYRQEVHAQVYACLARNQFGSIISRDVHVRAVVSQHYEEDIHKAFVIRG 153
            |:|..|      ......:.||:..||.|:|||:.||.:|.::                  |||.
Zfish    94 KVVMMPGTGNLVIDISGEKAEVYEGVYQCIARNEHGSAVSNNI------------------VIRQ 140

  Fly   154 NSAILKCDIPSFVADFVNVISWHSDEKENFYPGTEYDGKYLVLPSGELHIREVGPEDGYKSYQCR 218
            :.:.|                |..::.|   |.|...|..|:|                   |||
Zfish   141 SRSPL----------------WSKEKNE---PITVQRGTSLIL-------------------QCR 167

  Fly   219 TKHRLTGETRLSATKGRLVITEPVGSVSPQLSGNGNQEHITLTRVPKMGSVTLMCPAQAYPVPFF 283
                                                                   |....|.|..
Zfish   168 -------------------------------------------------------PPAGLPPPII 177

  Fly   284 RWYKFIEGTTRKQAVVLNDRVKQ-VSGTLIIKDAVVEDS-GKYLCVVNNSVGGESVETVLTVTAP 346
            .|.     ....|.:..|.||.| ::|.|...:.::||: ..|:|...                 
Zfish   178 FWM-----DNNFQRLPQNSRVSQALNGDLYFSNVIMEDTRNDYICYAR----------------- 220

  Fly   347 LSAKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFV 411
                 .|.|||:...:|.            ||.             ||.||::   :..:...|:
Zfish   221 -----FPHTQTIQQKQPI------------TVK-------------VLDIEAM---NDTVLAAFL 252

  Fly   412 RNDQESAEASAELKLGGRFDPPVIRQAFQEETME-PGPSVFLKCVAGGNPTPEISWELDGKKIAN 475
            .......::.:..::.....||    ..:..||. .|.::.|:|:|.|.|||.|||         
Zfish   253 NGSDFWGDSPSGERVPSFLHPP----GMESTTMVLKGDTLELECIADGLPTPNISW--------- 304

  Fly   476 NDRYQVGQYVTVNGDVVS----------YLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGL 530
                     ..|||::.|          .|.|..|...|||.|:||||:::|.::|:..:.|...
Zfish   305 ---------TKVNGELPSGRFSFYSFQKTLKIKEVTEADGGDYRCIAKNRMGSSQHTITVVVRAA 360

  Fly   531 PYIRQMEKKAIVA-GETLIVTCPVAGYPIDSIVWERDNRALPI----NRKQKVFPNGTLIIENVE 590
            |:.....:..|:| .||..:||.|.|.|..:|.|..:..  ||    |...:...:|.:.:.:|:
Zfish   361 PFWISAPQNLILAPKETGNLTCDVDGNPKPTITWSVNGN--PIESSHNDPSRKVSDGVITLSDVQ 423

  Fly   591 RNSDQATYTCVAKNQEGYSARGSLEVQVMVLPQIVPFAYEDLINMGDSIDLFCQIQKGDRPIKVH 655
            ..| .|.|.|.|.|..||....:. |.|:..|                                 
Zfish   424 TGS-SAVYQCNASNDYGYLLANAF-VSVLAEP--------------------------------- 453

  Fly   656 WSFERSAGDYGFDQVQPQMRTNRISEKTSMISIPSASPAHTGRDTCIASNKAGTTTYSVDLTVNV 720
                            |::.|: ::.:.|:||                                 
Zfish   454 ----------------PRVLTS-LNHEYSVIS--------------------------------- 468

  Fly   721 PPRWILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRV-EEGTLHV 784
                           .|.|.::|.:.|.|.|::||.|       :.:.:..||...: :.|||.:
Zfish   469 ---------------NSRALLDCASFGSPLPKITWFK-------DSQSILNSDLYHIHKNGTLEI 511

  Fly   785 DNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAP------PEFTEKLRNQTARRGEPAVLQCEAK 843
            :..|..|.|.|.|.|.|.:|:..:.| .:.|:.|      ||:.|..||..      ||.:|:.|
Zfish   512 NVAQPQNSGKYTCIASNNLGNKENHV-HLQVKEPTRIIRQPEYKEVQRNSI------AVFECKVK 569

  Fly   844 GEKPI--GILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSD 906
            .:..:  .::|..:|..|  .:|.|:.:..:        ||:|......|...:||:.......|
Zfish   570 HDPTLIPSMIWLKDNGEL--PDDPRFEVGSD--------SLTIHDVTEDDEGTYTCIRNTTLDQD 624

  Fly   907 DASINMIVQEV----------PEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRS--- 958
            .||..:.|.|.          |:.|..|::.|:..|||:|:|....:.|||:..::|:::.|   
Zfish   625 SASATLTVVEATPTPTMILEQPDPPTDLELTDQRERSVRLTWTPGDEHNSPIKLFLIQYEDSLHE 689

  Fly   959 RASWSEIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEA-PSGKPQN 1022
            ...|  ::...|.|.:|.||:: |||...|:.|::|.|.:|.|:||:.........| |...|.:
Zfish   690 PGVW--LNMTEVSGTSTTAQLE-LSPYVYYSFRVLALNGVGLSESSDPSRQYRTNPAKPDVNPSD 751

  Fly  1023 IKVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNL 1087
            ::|...:..||.::|:.....|.||..|.|.|.:::.:..........|.     .:|  .:...
Zfish   752 VEVSGTSPDTMTISWRELSGLESNGPGLQYKVSWRMKDAEQWTTVTLANV-----SQH--VVTGT 809

  Fly  1088 RVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLESANG 1152
            ..:|.|.|.:||.|..|.||..|....::.|.:|:..|.:...:..:.....|.|.:.||.|..|
Zfish   810 PTFTLYEVTVQAVNDYGEGPRPEVVLGYSGENSPTVAPENVKVSVQSGTEAEVHWEAVPLSSVRG 874

  Fly  1153 VIKTYKVVY----APSDEWYDETKRHYKKTASSDTV--LHGLKKYTNYTMQVLATTAGGDGVRSV 1211
            .:|.|||.|    :...:.||.........:..:||  |..|..|::|.:.:.|....|||..|.
Zfish   875 RLKGYKVTYQKMRSLHKQDYDRENPQVLIFSGEETVGRLPDLHPYSHYRLNIRAFNGHGDGPSST 939

  Fly  1212 PIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTV-YSKAEGAETETKTQKV-- 1273
            ....||...||..||:|....:...::||.|.||.:.||.:|.|.: |......|.....::|  
Zfish   940 DQQFQTPEGVPGPPTNVNIRNLNLDSLLVEWTPPLEDNGHLTGYLLKYQPINTTEEAGLLKEVLL 1004

  Fly  1274 PHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDTFTATFKEDAK 1338
            |..:.|:...:|..:..|:|::.|.|..|.|.                 |...:.||...:...:
Zfish  1005 PANETSYTLDKLTHSTHYKFFLNAMTETGSGP-----------------AVTKEAFTEVDEALIR 1052

  Fly  1339 MPCLAVG---------APQPEITWKIK-------------GVEFSANDRMRVL------PDGSLL 1375
            .|.:..|         .|.|.:|..::             .|..|..:...|:      |||::.
Zfish  1053 HPAVEAGKGSAPPSPPPPTPPVTQSLQPPFQAPPAGPMFGNVNSSVKEDHAVISWEYLGPDGNVY 1117

  Fly  1376 IKSVNRQDAGDYSCHAENS-------------------IAKDSITHKLIVLAPPQSPHVTLSATT 1421
            ::.|.......:.....|.                   :|||   |....:...|...:|:.|.|
Zfish  1118 VEYVVDNSKEPWKTEFVNGTRTFQIRGLKPGMSYRVRLVAKD---HSDATIHSTQEMLITVPAMT 1179

  Fly  1422 TDALTVK------------------------LKPHEGDTAPL-HGYTLHYKPE----------FG 1451
            .....:.                        :|.::|...|: .....|..||          ||
Zfish  1180 NRQAEIATQGWFIGLMCAIALLILVLLIVCFIKRNKGGKYPVKEKEDAHQDPEIQPMKEDDGTFG 1244

  Fly  1452 EWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPEKPRFIEVS 1516
            |:.      |::.|.   .|.|||.....|    :...::.|.|....:|...:..|...||...
Zfish  1245 EYS------DTEDHK---PLKGSRTPSNGT----VKKDDSDDSLVDYGEGGDGQFNEDGSFIGQY 1296

  Fly  1517 SNSVSLHFKAWKDGGCPMSHFVVESKKRDQIEWNQISNNVKPDN 1560
            |.                      .|::|..|.|:.|....|.|
Zfish  1297 SG----------------------KKEKDTAEGNESSEAPSPVN 1318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 IgI_1_Dscam 38..136 CDD:409547 28/104 (27%)
Ig strand A 39..42 CDD:409547 1/3 (33%)
Ig strand A' 48..52 CDD:409547 1/3 (33%)
Ig strand B 55..64 CDD:409547 2/8 (25%)
Ig strand C 70..76 CDD:409547 1/5 (20%)
Ig strand C' 78..81 CDD:409547 2/2 (100%)
Ig strand D 87..90 CDD:409547 0/2 (0%)
Ig strand E 95..100 CDD:409547 2/4 (50%)
Ig strand F 113..121 CDD:409547 4/7 (57%)
Ig strand G 124..136 CDD:409547 3/11 (27%)
IgI_2_Dscam 246..343 CDD:409545 15/98 (15%)
Ig strand A 247..250 CDD:409545 0/2 (0%)
Ig strand A' 260..264 CDD:409545 0/3 (0%)
Ig strand B 267..274 CDD:409545 0/6 (0%)
Ig strand C 282..288 CDD:409545 1/5 (20%)
Ig strand C' 294..297 CDD:409545 0/2 (0%)
Ig strand D 303..307 CDD:409545 3/4 (75%)
Ig strand E 309..315 CDD:409545 2/5 (40%)
Ig strand F 322..330 CDD:409545 2/7 (29%)
Ig strand G 333..343 CDD:409545 0/9 (0%)
IgC2_3_Dscam 346..426 CDD:409549 12/79 (15%)
Ig strand A 347..352 CDD:409549 0/4 (0%)
Ig strand A' 355..359 CDD:409549 3/3 (100%)
Ig strand B 362..372 CDD:409549 1/9 (11%)
Ig strand C 377..383 CDD:409549 2/5 (40%)
Ig strand C' 384..387 CDD:409549 0/2 (0%)
Ig strand E 392..398 CDD:409549 3/5 (60%)
Ig strand F 405..413 CDD:409549 1/7 (14%)
Ig strand G 416..426 CDD:409549 0/9 (0%)
IgI_4_Dscam 432..527 CDD:409548 32/105 (30%)
Ig strand A 432..435 CDD:409548 2/2 (100%)
Ig strand A' 441..445 CDD:409548 1/3 (33%)
Ig strand B 448..457 CDD:409548 2/8 (25%)
Ig strand C 462..468 CDD:409548 4/5 (80%)
Ig strand C' 470..473 CDD:409548 0/2 (0%)
Ig strand D 478..486 CDD:409548 0/7 (0%)
Ig strand E 490..499 CDD:409548 3/18 (17%)
Ig strand F 506..514 CDD:409548 5/7 (71%)
Ig strand G 517..527 CDD:409548 2/9 (22%)
IgI_5_Dscam 531..618 CDD:409550 26/91 (29%)
Ig strand A 531..533 CDD:409550 1/1 (100%)
Ig strand A' 538..542 CDD:409550 0/3 (0%)
Ig strand B 545..552 CDD:409550 3/6 (50%)
Ig strand C 559..565 CDD:409550 2/5 (40%)
Ig strand C' 566..568 CDD:409550 0/1 (0%)
Ig strand D 575..579 CDD:409550 0/3 (0%)
Ig strand E 582..588 CDD:409550 1/5 (20%)
Ig strand F 596..604 CDD:409550 4/7 (57%)
Ig strand G 608..618 CDD:409550 2/9 (22%)
Ig 621..718 CDD:472250 6/96 (6%)
Ig strand B 639..643 CDD:409353 0/3 (0%)
Ig strand C 653..657 CDD:409353 0/3 (0%)
Ig strand E 684..688 CDD:409353 2/3 (67%)
Ig strand F 698..703 CDD:409353 0/4 (0%)
Ig strand G 711..714 CDD:409353 0/2 (0%)
IgI_7_Dscam 721..815 CDD:409546 23/94 (24%)
Ig strand A 721..725 CDD:409546 0/3 (0%)
Ig strand A' 730..734 CDD:409546 0/3 (0%)
Ig strand B 737..746 CDD:409546 3/8 (38%)
Ig strand C 752..758 CDD:409546 2/5 (40%)
Ig strand C' 764..767 CDD:409546 0/2 (0%)
Ig strand D 775..778 CDD:409546 0/3 (0%)
Ig strand E 780..786 CDD:409546 3/5 (60%)
Ig strand F 793..801 CDD:409546 4/7 (57%)
Ig strand G 806..815 CDD:409546 1/8 (13%)
Ig 818..916 CDD:472250 25/105 (24%)
Ig strand B 836..840 CDD:409353 2/3 (67%)
Ig strand C 849..853 CDD:409353 0/3 (0%)
Ig strand E 880..884 CDD:409353 2/3 (67%)
Ig strand F 894..899 CDD:409353 2/4 (50%)
FN3 <899..1212 CDD:442628 88/332 (27%)
Ig strand G 907..910 CDD:409353 1/2 (50%)
FN3 1222..1312 CDD:238020 25/92 (27%)
Ig <1339..1406 CDD:472250 17/113 (15%)
Ig strand C 1350..1354 CDD:409358 1/3 (33%)
Ig strand E 1372..1376 CDD:409358 1/3 (33%)
Ig strand F 1386..1391 CDD:409358 0/4 (0%)
Ig strand G 1399..1402 CDD:409358 0/2 (0%)
FN3 1409..1499 CDD:238020 22/124 (18%)
FN3 1504..1584 CDD:238020 11/57 (19%)
Dscam_C 1893..2008 CDD:463546
nrcamaXP_005164693.1 Ig 46..139 CDD:472250 30/126 (24%)
Ig strand B 64..68 CDD:409458 2/11 (18%)
Ig strand C 77..81 CDD:409458 0/3 (0%)
Ig strand E 102..106 CDD:409458 0/3 (0%)
Ig strand F 119..124 CDD:409458 3/4 (75%)
Ig strand G 133..136 CDD:409458 1/2 (50%)
Ig 148..238 CDD:472250 31/218 (14%)
Ig strand B 162..166 CDD:409432 2/22 (9%)
Ig strand C 176..180 CDD:409432 0/3 (0%)
Ig strand E 199..203 CDD:409432 2/3 (67%)
Ig strand F 214..219 CDD:409432 2/4 (50%)
Ig strand G 230..233 CDD:409432 0/2 (0%)
Ig3_L1-CAM_like 276..358 CDD:409394 30/99 (30%)
Ig strand B 288..292 CDD:409394 1/3 (33%)
Ig strand C 301..305 CDD:409394 3/21 (14%)
Ig strand E 323..327 CDD:409394 1/3 (33%)
Ig strand F 337..342 CDD:409394 2/4 (50%)
Ig strand G 350..353 CDD:409394 1/2 (50%)
Ig 362..450 CDD:472250 25/91 (27%)
Ig strand B 378..382 CDD:409454 0/3 (0%)
Ig strand C 391..395 CDD:409454 1/3 (33%)
Ig strand E 415..419 CDD:409454 1/3 (33%)
Ig strand F 429..434 CDD:409454 2/4 (50%)
Ig strand G 442..445 CDD:409454 0/2 (0%)
I-set 466..541 CDD:400151 25/130 (19%)
Ig strand B 472..476 CDD:409544 1/3 (33%)
Ig strand C 485..489 CDD:409544 1/3 (33%)
Ig strand E 507..511 CDD:409544 3/3 (100%)
Ig strand F 521..526 CDD:409544 2/4 (50%)
Ig strand G 534..537 CDD:409544 0/2 (0%)
Ig 546..632 CDD:472250 23/101 (23%)
Ig strand B 562..566 CDD:409390 2/3 (67%)
Ig strand C 577..581 CDD:409390 0/3 (0%)
Ig strand E 599..602 CDD:409390 2/2 (100%)
Ig strand F 612..617 CDD:409390 2/4 (50%)
Ig strand G 625..628 CDD:409390 1/2 (50%)
FN3 646..736 CDD:238020 31/92 (34%)
FN3 748..834 CDD:238020 23/92 (25%)
fn3 846..938 CDD:394996 24/91 (26%)
fn3 951..1036 CDD:394996 23/84 (27%)
fn3 1096..1157 CDD:394996 7/60 (12%)
Bravo_FIGEY 1212..1300 CDD:464016 23/122 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.