DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and KIRREL1

DIOPT Version :9

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:920 Identity:195/920 - (21%)
Similarity:307/920 - (33%) Gaps:272/920 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 DPPTQTVDFGRPAVFTC---QYTGNPIKTVSWMKDGKAIGHSE-----PVLRIESVKKEDKGMYQ 408
            :|..|||..|:.||..|   .|:|    .|.|.|||.|:|..:     |..|:  |...|.|.|.
Human    26 EPADQTVVAGQRAVLPCVLLNYSG----IVQWTKDGLALGMGQGLKAWPRYRV--VGSADAGQYN 84

  Fly   409 CFVRNDQESAEAS-----AELKLGGR------FDPPVIRQAFQEETMEPGPSVFLK--------C 454
            ..:.:.:.|.:||     .|..|..|      ..||      ::..::.||.:.|:        |
Human    85 LEITDAELSDDASYECQATEAALRSRRAKLTVLIPP------EDTRIDGGPVILLQAGTPHNLTC 143

  Fly   455 VA-GGNPTPEISWELDGKK----IANNDRYQVGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKS 514
            .| ...|...|.|..||.:    :|:.:..:.|:..|    .||.|.|.....:.|.::.|.:.:
Human   144 RAFNAKPAATIIWFRDGTQQEGAVASTELLKDGKRET----TVSQLLINPTDLDIGRVFTCRSMN 204

  Fly   515 KV--GVAEHSAKLNVYGLPYIR-QMEKKAIVAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQ 576
            :.  ...|.|.:|:|:..|.:. .:|.:.:..||.::.||                         
Human   205 EAIPSGKETSIELDVHHPPTVTLSIEPQTVQEGERVVFTC------------------------- 244

  Fly   577 KVFPNGTLIIENVERNSDQATYTCVAKNQE--GYS-ARGSLEVQVMVLPQIVPFAYEDLINMGDS 638
                              |||     .|.|  ||. |:|.             |..||       
Human   245 ------------------QAT-----ANPEILGYRWAKGG-------------FLIED------- 266

  Fly   639 IDLFCQIQKGDRPIKVHWSFERSAGDYGFDQVQPQMRTNRISEKTSMISIPSASPAHTGRDTCIA 703
                           .|.|...:..||.|           .:|..|                |..
Human   267 ---------------AHESRYETNVDYSF-----------FTEPVS----------------CEV 289

  Fly   704 SNKAGTTTYSVDLTVNVPPRWILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGD----TPG 764
            .||.|:|..|..:.|:..||.:::|.......|||..:.|...|.|...:||.|...:    .||
Human   290 HNKVGSTNVSTLVNVHFAPRIVVDPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMGPRPPG 354

  Fly   765 EYKDLKKSDNIRVEEGTLHVDNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQT 829
            ...:...|..:......|.:.::.:.:.|.|.|.||..........:.:.|..||..:.: ..|.
Human   355 SPPEAALSAQVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSE-AVQY 418

  Fly   830 ARRGEPAVLQC-EAKGEKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSD-S 892
            |.||:...::| ......|..|.|......|:.....|||:......:||:|:|:|.....:| .
Human   419 AVRGDGGKVECFIGSTPPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQ 483

  Fly   893 ALFTCVATNAFGSDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIE--- 954
            ..:.|.|.|:||...|.|.:..:||  :|..:......|.|:.|.:            :.|.   
Human   484 THYNCTAWNSFGPGTAIIQLEEREV--LPVGIIAGATIGASILLIF------------FFIALVF 534

  Fly   955 --FKRSRASWSE------------IDRVIVPGHT-TEAQVQKLSPATTYNIRIVA--ENAIGTSQ 1002
              ::|.:.|..:            ::|..:..|: .|.....:|.||.....|.:  ::.:...|
Human   535 FLYRRRKGSRKDVTLRKLDIKVETVNREPLTMHSDREDDTASVSTATRVMKAIYSSFKDDVDLKQ 599

  Fly  1003 SSEAVTIITAEE----APSGKPQNIKV---EPVNQTTMRVTWKPPPRTEWNG---EILGYYVGYK 1057
            .....||.|.||    .|:....|::.   .|.::..:...::.|....::|   ..|.:..||.
Human   600 DLRCDTIDTREEYEMKDPTNGYYNVRAHEDRPSSRAVLYADYRAPGPARFDGRPSSRLSHSSGYA 664

  Fly  1058 LSNTNSSYVFETINFITEEGKEHNLELQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPS 1122
            ..||.|                                         .||.|:    :..|.||.
Human   665 QLNTYS-----------------------------------------RGPASD----YGPEPTPP 684

  Fly  1123 QP--PSDTACTTLTSQTIRVGWVSPPLESANGVIKTYKVVY--APSD-------EWYDETKRHYK 1176
            .|  |:.|..|:..|......:.|.|...|.| ..||::.|  ||..       |.||...::..
Human   685 GPAAPAGTDTTSQLSYENYEKFNSHPFPGAAG-YPTYRLGYPQAPPSGLERTPYEAYDPIGKYAT 748

  Fly  1177 KTASSDTVLH 1186
            .|..|.|..|
Human   749 ATRFSYTSQH 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653
Ig 269..340 CDD:143165
IG_like 353..425 CDD:214653 27/84 (32%)
IGc2 361..413 CDD:197706 19/59 (32%)
I-set 433..527 CDD:254352 23/108 (21%)
IGc2 446..517 CDD:197706 19/85 (22%)
I-set 533..618 CDD:254352 14/88 (16%)
IGc2 544..607 CDD:197706 9/64 (14%)
Ig 641..714 CDD:143165 12/72 (17%)
IGc2 735..804 CDD:197706 18/72 (25%)
I-set 819..914 CDD:254352 26/96 (27%)
Ig 833..921 CDD:299845 24/89 (27%)
FN3 918..1011 CDD:238020 17/112 (15%)
FN3 1018..1116 CDD:238020 13/103 (13%)
FN3 1124..1217 CDD:238020 21/74 (28%)
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352 29/95 (31%)
Ig 25..116 CDD:299845 29/95 (31%)
Ig2_KIRREL3-like 138..219 CDD:143236 19/84 (23%)
I-set 223..304 CDD:254352 31/190 (16%)
Ig_2 227..305 CDD:290606 30/187 (16%)
Ig_2 311..405 CDD:290606 19/93 (20%)
IG_like 314..405 CDD:214653 19/90 (21%)
Ig5_KIRREL3 407..504 CDD:143306 27/97 (28%)
IG_like 416..504 CDD:214653 25/87 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10991
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.