DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and CNTN3

DIOPT Version :10

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:NP_065923.1 Gene:CNTN3 / 5067 HGNCID:2173 Length:1028 Species:Homo sapiens


Alignment Length:1366 Identity:292/1366 - (21%)
Similarity:472/1366 - (34%) Gaps:421/1366 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 WLMLFAAVALIAC-GSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAE-----IECKASGNPM 68
            |..|. .::.|.| |.:.|.        :||||:|||:|.|   ...|:|     :.|:|.|||.
Human     5 WKQLI-LLSFIGCLGGELLL--------QGPVFIKEPSNSI---FPVGSEDKKITLHCEARGNPS 57

  Fly    69 PEIIWIRSDGTAVGDVPGLRQISSDGKL-VFPPFRAEDYRQEVHAQVYACLARNQFGSIISRDVH 132
            |...| :.:|:.:......|...:.|.| |..|.|..|      ...|.|.|.|..|:|:||:..
Human    58 PHYRW-QLNGSDIDMSMEHRYKLNGGNLVVINPNRNWD------TGTYQCFATNSLGTIVSREAK 115

  Fly   133 VRAVVSQHYEEDIHKAFVIR-GNSAILKCDIPSFVADFVNVISWHSDEKENFYPGTEYDGKYLVL 196
            ::....::::..:.....:| |...:|.|..|..                               
Human   116 LQFAYLENFKTKMRSTVSVREGQGVVLLCGPPPH------------------------------- 149

  Fly   197 PSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVGSVSPQLSGNGNQEHITLT 261
             ||||                                                            
Human   150 -SGEL------------------------------------------------------------ 153

  Fly   262 RVPKMGSVTLMCPAQAYPVPFFRWYKFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLC 326
                           :|...|..:..|:|..:|:       .|.|.:|.|.|......|.|.|.|
Human   154 ---------------SYAWIFNEYPSFVEEDSRR-------FVSQETGHLYISKVEPSDVGNYTC 196

  Fly   327 VVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGKAIGHSE 391
            ||                                                 .|.:.:.:.:|...
Human   197 VV-------------------------------------------------TSMVTNARVLGSPT 212

  Fly   392 P-VLRIESVKKEDKGMYQCFVRNDQESAEASAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCV 455
            | |||.:.|.                           |.::|.:..|..:......|.:|.|:|.
Human   213 PLVLRSDGVM---------------------------GEYEPKIEVQFPETLPAAKGSTVKLECF 250

  Fly   456 AGGNPTPEISW-ELDGKKIANNDRYQVGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVA 519
            |.|||.|:|:| ..||  :..:.:.::.::..|       |.|.:....|.|.|:|||::..|..
Human   251 ALGNPIPQINWRRSDG--LPFSSKIKLRKFSGV-------LEIPNFQQEDAGSYECIAENSRGKN 306

  Fly   520 EHSAKLNVYGLPYIRQMEKKAIVAGE-TLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGT 583
            ....:|..|..|:..|:.|...:|.| :|...|..:|.|..|..|.::..||.:..:.:: .||.
Human   307 VARGRLTYYAKPHWVQLIKDVEIAVEDSLYWECRASGKPKPSYRWLKNGAALVLEERTQI-ENGA 370

  Fly   584 LIIENVERNSDQATYTCVAKNQEG--YSARGSLEVQVMVLPQIVPFAYEDLINMGDSIDLFCQIQ 646
            |.|.|:. .:|...:.|:|:|:.|  ||   |.|::|:.                          
Human   371 LTISNLS-VTDSGMFQCIAENKHGLVYS---SAELKVVA-------------------------- 405

  Fly   647 KGDRPIKVHWSFERSAGDYGFDQVQPQMRTNRISEKTSMISIPSASPAHTGRDTCIASNKAGTTT 711
                          ||.|:..:.:          :|...:.:                       
Human   406 --------------SAPDFSKNPM----------KKLVQVQV----------------------- 423

  Fly   712 YSVDLTVNVPPRWILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIR 776
                                    ||...::||....|:...:|||.         |:...::.|
Human   424 ------------------------GSLVSLDCKPRASPRALSSWKKG---------DVSVQEHER 455

  Fly   777 V---EEGTLHVDNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVL 838
            :   .:|.|.:.|:.|.:.|.|.|.|.|..|.......:: |..|...|....|.....||..:|
Human   456 ISLLNDGGLKIANVTKADAGTYTCMAENQFGKANGTTHLV-VTEPTRITLAPSNMDVSVGESVIL 519

  Fly   839 QCEAKGEKPIGIL--WNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATN 901
            .|:.:.:..:.|:  |..|....|.|.|..:..:....|:|   .|.|:..:...|..:.|:...
Human   520 PCQVQHDPLLDIIFTWYFNGALADFKKDGSHFEKVGGSSSG---DLMIRNIQLKHSGKYVCMVQT 581

  Fly   902 AFGSDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRS-RASWSEI 965
            ...|..::.::||:..|..|..:||.:.:..:.||||.:..|.:||:..|.|:.:.. ...|..:
Human   582 GVDSVSSAADLIVRGSPGPPENVKVDEITDTTAQLSWKEGKDNHSPVISYSIQARTPFSVGWQTV 646

  Fly   966 DRV--IVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEA-PSGKPQNIKVEP 1027
            ..|  ::.|.|..|.|.:|:|...|..|:||.|.||..:.|.....:..||| |...|..:....
Human   647 TTVPEVIDGKTHTATVVELNPWVEYEFRVVASNKIGGGEPSLPSEKVRTEEAVPEVPPSEVNGGG 711

  Fly  1028 VNQTTMRVTWKPPPRTEWNGEILGYYVGYK------------LSNTNSSYVFETINFITEEGKEH 1080
            .:::.:.:||.|.|....|||..||.|.::            .|.....|||..           
Human   712 GSRSELVITWDPVPEELQNGEGFGYVVAFRPLGVTTWIQTVVTSPDTPRYVFRN----------- 765

  Fly  1081 NLELQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSP 1145
                :::..|:.|.|.:..:|..|.||.|.....|:||..|:..||..:..:|:|..|.|.|.:.
Human   766 ----ESIVPYSPYEVKVGVYNNKGEGPFSPVTTVFSAEEEPTVAPSQVSANSLSSSEIEVSWNTI 826

  Fly  1146 PLESANGVIKTYKVVYAPSDEWY---DETKRHYKKTASSDTV--LHGLKKYTNYTMQVLATTAGG 1205
            |.:.:||.:..|:|.|     |.   .|......|.|.::|.  |.|||....|...|.|..:.|
Human   827 PWKLSNGHLLGYEVRY-----WNGGGKEESSSKMKVAGNETSARLRGLKSNLAYYTAVRAYNSAG 886

  Fly  1206 DGVRSVPIHCQTEPDVPEAP--------TDVKALVMGNAAILVSW-RPPAQPN-GIITQYTVYSK 1260
            .|..|..::..|:...|..|        ||.|        :|::| :..|..| ..:|.|.|:.:
Human   887 AGPFSATVNVTTKKTPPSQPPGNVVWNATDTK--------VLLNWEQVKAMENESEVTGYKVFYR 943

  Fly  1261 AEGAETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASF 1325
               ..::...|.:...:.|.|.. |...:.|...|.|:|..|:|..|:.|      ::| :|.|.
Human   944 ---TSSQNNVQVLNTNKTSAELV-LPIKEDYIIEVKATTDGGDGTSSEQI------RIP-RITSM 997

  Fly  1326 D 1326
            |
Human   998 D 998

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 IgI_1_Dscam 38..136 CDD:409547 34/103 (33%)
Ig strand A 39..42 CDD:409547 2/2 (100%)
Ig strand A' 48..52 CDD:409547 1/3 (33%)
Ig strand B 55..64 CDD:409547 3/13 (23%)
Ig strand C 70..76 CDD:409547 1/5 (20%)
Ig strand C' 78..81 CDD:409547 1/2 (50%)
Ig strand D 87..90 CDD:409547 1/2 (50%)
Ig strand E 95..100 CDD:409547 2/5 (40%)
Ig strand F 113..121 CDD:409547 3/7 (43%)
Ig strand G 124..136 CDD:409547 4/11 (36%)
IgI_2_Dscam 246..343 CDD:409545 16/96 (17%)
Ig strand A 247..250 CDD:409545 0/2 (0%)
Ig strand A' 260..264 CDD:409545 0/3 (0%)
Ig strand B 267..274 CDD:409545 0/6 (0%)
Ig strand C 282..288 CDD:409545 1/5 (20%)
Ig strand C' 294..297 CDD:409545 1/2 (50%)
Ig strand D 303..307 CDD:409545 1/3 (33%)
Ig strand E 309..315 CDD:409545 3/5 (60%)
Ig strand F 322..330 CDD:409545 5/7 (71%)
Ig strand G 333..343 CDD:409545 0/9 (0%)
IgC2_3_Dscam 346..426 CDD:409549 7/80 (9%)
Ig strand A 347..352 CDD:409549 0/4 (0%)
Ig strand A' 355..359 CDD:409549 0/3 (0%)
Ig strand B 362..372 CDD:409549 0/9 (0%)
Ig strand C 377..383 CDD:409549 1/5 (20%)
Ig strand C' 384..387 CDD:409549 0/2 (0%)
Ig strand E 392..398 CDD:409549 4/6 (67%)
Ig strand F 405..413 CDD:409549 0/7 (0%)
Ig strand G 416..426 CDD:409549 0/9 (0%)
IgI_4_Dscam 432..527 CDD:409548 26/95 (27%)
Ig strand A 432..435 CDD:409548 1/2 (50%)
Ig strand A' 441..445 CDD:409548 0/3 (0%)
Ig strand B 448..457 CDD:409548 3/8 (38%)
Ig strand C 462..468 CDD:409548 3/6 (50%)
Ig strand C' 470..473 CDD:409548 1/2 (50%)
Ig strand D 478..486 CDD:409548 0/7 (0%)
Ig strand E 490..499 CDD:409548 2/8 (25%)
Ig strand F 506..514 CDD:409548 5/7 (71%)
Ig strand G 517..527 CDD:409548 2/9 (22%)
IgI_5_Dscam 531..618 CDD:409550 27/89 (30%)
Ig strand A 531..533 CDD:409550 1/1 (100%)
Ig strand A' 538..542 CDD:409550 1/3 (33%)
Ig strand B 545..552 CDD:409550 2/7 (29%)
Ig strand C 559..565 CDD:409550 2/5 (40%)
Ig strand C' 566..568 CDD:409550 0/1 (0%)
Ig strand D 575..579 CDD:409550 0/3 (0%)
Ig strand E 582..588 CDD:409550 3/5 (60%)
Ig strand F 596..604 CDD:409550 2/7 (29%)
Ig strand G 608..618 CDD:409550 4/9 (44%)
Ig 621..718 CDD:472250 4/96 (4%)
Ig strand B 639..643 CDD:409353 0/3 (0%)
Ig strand C 653..657 CDD:409353 0/3 (0%)
Ig strand E 684..688 CDD:409353 0/3 (0%)
Ig strand F 698..703 CDD:409353 0/4 (0%)
Ig strand G 711..714 CDD:409353 0/2 (0%)
IgI_7_Dscam 721..815 CDD:409546 20/96 (21%)
Ig strand A 721..725 CDD:409546 0/3 (0%)
Ig strand A' 730..734 CDD:409546 0/3 (0%)
Ig strand B 737..746 CDD:409546 3/8 (38%)
Ig strand C 752..758 CDD:409546 2/5 (40%)
Ig strand C' 764..767 CDD:409546 0/2 (0%)
Ig strand D 775..778 CDD:409546 1/5 (20%)
Ig strand E 780..786 CDD:409546 2/5 (40%)
Ig strand F 793..801 CDD:409546 4/7 (57%)
Ig strand G 806..815 CDD:409546 0/8 (0%)
Ig 818..916 CDD:472250 22/99 (22%)
Ig strand B 836..840 CDD:409353 1/3 (33%)
Ig strand C 849..853 CDD:409353 1/5 (20%)
Ig strand E 880..884 CDD:409353 1/3 (33%)
Ig strand F 894..899 CDD:409353 1/4 (25%)
FN3 <899..1212 CDD:442628 91/333 (27%)
Ig strand G 907..910 CDD:409353 0/2 (0%)
FN3 1222..1312 CDD:238020 24/99 (24%)
Ig <1339..1406 CDD:472250
Ig strand C 1350..1354 CDD:409358
Ig strand E 1372..1376 CDD:409358
Ig strand F 1386..1391 CDD:409358
Ig strand G 1399..1402 CDD:409358
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1893..2008 CDD:463546
CNTN3NP_065923.1 Ig 25..120 CDD:472250 34/104 (33%)
Ig strand B 46..50 CDD:409353 0/3 (0%)
Ig strand C 59..63 CDD:409353 1/4 (25%)
Ig strand E 82..86 CDD:409353 2/3 (67%)
Ig strand F 97..102 CDD:409353 2/4 (50%)
Ig strand G 111..114 CDD:409353 2/2 (100%)
Ig 129..214 CDD:472250 27/247 (11%)
Ig strand B 140..144 CDD:409353 1/3 (33%)
Ig strand C 154..158 CDD:409353 1/3 (33%)
Ig strand E 179..183 CDD:409353 2/3 (67%)
Ig strand F 193..198 CDD:409353 2/4 (50%)
Ig strand G 209..212 CDD:409353 1/2 (50%)
Ig 227..315 CDD:472250 26/96 (27%)
Ig strand B 245..249 CDD:409353 2/3 (67%)
Ig strand C 258..262 CDD:409353 1/3 (33%)
Ig strand E 280..284 CDD:409353 2/10 (20%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
Ig strand G 307..310 CDD:409353 0/2 (0%)
Ig 320..403 CDD:472250 26/87 (30%)
Ig strand B 335..339 CDD:143205 1/3 (33%)
Ig strand C 348..352 CDD:143205 1/3 (33%)
Ig strand E 369..373 CDD:143205 2/3 (67%)
Ig strand F 383..388 CDD:143205 1/4 (25%)
Ig strand G 396..399 CDD:143205 2/5 (40%)
Ig 408..496 CDD:472250 22/154 (14%)
Ig strand B 427..431 CDD:409353 0/3 (0%)
Ig strand C 440..444 CDD:409353 0/3 (0%)
Ig strand E 462..466 CDD:409353 2/3 (67%)
Ig strand F 476..481 CDD:409353 2/4 (50%)
Ig strand G 489..492 CDD:409353 0/2 (0%)
Ig 498..598 CDD:472250 22/102 (22%)
Ig strand B 517..521 CDD:409439 1/3 (33%)
Ig strand C 532..536 CDD:409439 0/3 (0%)
Ig strand E 560..564 CDD:409439 2/6 (33%)
Ig strand F 574..579 CDD:409439 1/4 (25%)
FN3 579..>1006 CDD:442628 120/459 (26%)
Ig strand G 587..590 CDD:409439 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 684..713 6/28 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.