DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and dpr6

DIOPT Version :9

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster


Alignment Length:303 Identity:75/303 - (24%)
Similarity:117/303 - (38%) Gaps:96/303 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 VSGTLIIKDAVVEDSGKYLCVVNNSVGG-----ESVETVLTV------------TAPLSA----- 349
            |:..|::...|:.|      :.|..|.|     .|::.:||.            |||.:|     
  Fly    11 VAWLLLLVVIVMSD------MTNGGVQGPIEGYNSLDDLLTTTPTPGQAALLLPTAPTAAYTHPK 69

  Fly   350 ----KIDPPTQ---TVDFGRPAVFTCQYTGNPIKTVSWMKDG------------------KAIGH 389
                ..||.|.   |...|:.|..:|:......|||||::..                  :|..|
  Fly    70 WMEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHH 134

  Fly   390 SEP---VLRIESVKKEDKGMYQC----------FVRNDQESAEASAELKLGGRFDPPVIRQAFQE 441
            .:.   .|:|:..:|.|.|||:|          |||.:.....|:.   |||    |.:.     
  Fly   135 QDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATI---LGG----PDLH----- 187

  Fly   442 ETMEPGPSVFLKCVAGGNPTPE--ISWELDGKKIANNDRYQVG-QYVTVNGDV-VSYLNITSVHA 502
              ::.|.::.|.|....:|.|.  |.| ...:::.|.|..:.| ..:|..||| .|:|.|.:...
  Fly   188 --VDKGSTINLTCTVKFSPEPPAYIFW-YHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADL 249

  Fly   503 NDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGE 545
            .|.|.|.| |.|...||  |.:::|        :..:||::||
  Fly   250 ADSGKYSC-APSNADVA--SVRVHV--------LNVRAIISGE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653 9/40 (23%)
Ig 269..340 CDD:143165 8/37 (22%)
IG_like 353..425 CDD:214653 25/105 (24%)
IGc2 361..413 CDD:197706 20/82 (24%)
I-set 433..527 CDD:254352 27/97 (28%)
IGc2 446..517 CDD:197706 23/74 (31%)
I-set 533..618 CDD:254352 4/13 (31%)
IGc2 544..607 CDD:197706 2/2 (100%)
Ig 641..714 CDD:143165
IGc2 735..804 CDD:197706
I-set 819..914 CDD:254352
Ig 833..921 CDD:299845
FN3 918..1011 CDD:238020
FN3 1018..1116 CDD:238020
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
dpr6NP_001287018.1 V-set 79..174 CDD:284989 23/94 (24%)
IG_like 80..175 CDD:214653 22/94 (23%)
IG_like 184..271 CDD:214653 27/97 (28%)
IGc2 191..262 CDD:197706 23/72 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.