DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and Nrcam

DIOPT Version :10

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:XP_038968603.1 Gene:Nrcam / 497815 RGDID:3209 Length:1311 Species:Rattus norvegicus


Alignment Length:1526 Identity:327/1526 - (21%)
Similarity:533/1526 - (34%) Gaps:473/1526 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PPDADQKGPV-FLKEPTNRIDFSNSTGAEIECKASGNPMPEIIWIRSDGT--------AVGDVPG 86
            ||...|:.|. ::.:|...|        .|:|:|.|.|.|...|.| :||        .|...||
  Rat    49 PPTITQQSPKDYIIDPRENI--------VIQCEAKGKPPPSFSWTR-NGTHFDIDKDPLVTMKPG 104

  Fly    87 ----LRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQFGSIISRDVHVRAVVSQHYEEDIHK 147
                :..|.|:||       ||.|.     .||.|.|||:.|:.:|.::.||...|..:.::..:
  Rat   105 SGTLVINIMSEGK-------AETYE-----GVYQCTARNERGAAVSNNIVVRPSRSPLWTKERLE 157

  Fly   148 AFVIR-GNSAILKCDIPSFVADFVNVISWHSDEKENFYPGTEYDGKYLVLPSGELHIREVGPEDG 211
            ..::| |.|.:|.|..|..:..  .:|.| .|......|.:|...:.|   :|:|:...|.|||.
  Rat   158 PIILRSGQSLVLPCRPPIGLPP--AIIFW-MDNSFQRLPQSERVSQGL---NGDLYFSNVLPEDT 216

  Fly   212 YKSYQC--RTKHRLTGETRLSATKGRLVITEPVGSVSPQLSGNGNQEHITLTRVPKMGSVTLMCP 274
            .:.|.|  |..|                 |:.:....|          |:|    |:.||.    
  Rat   217 REDYICYARFNH-----------------TQTIQQKQP----------ISL----KVISVD---- 246

  Fly   275 AQAYPVPFFRWYKFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVET 339
                                    .|||.:.          |.:.|:..|        |.:    
  Rat   247 ------------------------ELNDTIA----------ANLSDTEFY--------GAK---- 265

  Fly   340 VLTVTAPLSAKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDK 404
                    |:|..|||    |..|       .||                       ||.|:|.:
  Rat   266 --------SSKERPPT----FLTP-------EGN-----------------------ESHKEELR 288

  Fly   405 GMYQCFVRNDQESAEASAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISW-EL 468
            |..                                          :.|:|:|.|.|||.|.| :.
  Rat   289 GNV------------------------------------------LSLECIAEGLPTPVIYWIKE 311

  Fly   469 DGKKIANNDRYQVGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPY- 532
            ||....|...|:         :....|.|..|...|.|.|:||||:.:|...|:..:.|...|| 
  Rat   312 DGTLPVNRTFYR---------NFKKTLQIIHVSEADSGNYQCIAKNALGAVHHTISVTVKAAPYW 367

  Fly   533 IRQMEKKAIVAGETLIVTCPVAGYPIDSIVWERDNRALPI-----NRKQKVFPNGTLIIENVERN 592
            |.......:..||...:.|...|.|...|.|..:...:.|     :||   ....|::..||:.:
  Rat   368 IVAPHNLVLSPGENGTLICRANGNPKPRISWLTNGVPVEIALDDPSRK---IDGDTIMFSNVQES 429

  Fly   593 SDQATYTCVAKNQEGYSARGSLEVQVMVLPQIVPFAYEDLINMGDSIDLFCQIQKGDRPIKVHWS 657
            | .|.|.|.|.|:.||....:. |.|:..|                                   
  Rat   430 S-SAVYQCNASNKYGYLLANAF-VNVLAEP----------------------------------- 457

  Fly   658 FERSAGDYGFDQVQPQMRTNRISEKTSMISIPSASPAHTGRDTCIASNKAGTTTYSVDLTVNVPP 722
                          |::.|                              :..|.|.|  ..|.| 
  Rat   458 --------------PRILT------------------------------SANTLYQV--IANRP- 475

  Fly   723 RWILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGE--YKDLKKSDNIRVEEGTLHVD 785
                            |.::|...|.|.|.:.|.|.   |.|.  ::|:    .:..:.|||.:.
  Rat   476 ----------------ALLDCAFFGSPMPTIEWFKG---TKGSALHEDI----YVLHDNGTLEIP 517

  Fly   786 NIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPI-- 848
            ..||.:.|.|.|.|.|.:|...:.| .:.::.|..|.::......:||.....:|:.|.:..:  
  Rat   518 VAQKDSTGTYTCVARNKLGMAKNEV-HLEIKDPTRFIKQPEYAVVQRGSKVSFECKVKHDHTLIP 581

  Fly   849 GILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDAS--IN 911
            .|||..:|..|  .||.|:::.::        .|.:...:..|...:||.|.....|..||  :.
  Rat   582 TILWLKDNGEL--PNDERFSVDKD--------HLVVSDVKDEDGGTYTCAANTTLDSVSASAVLR 636

  Fly   912 MI--------VQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFK---RSRASWSEI 965
            ::        :.:||..|:.|::.::..:||||:|....|.|||:.::|||::   .....|.. 
  Rat   637 VVAPTPTPAPIYDVPNPPFDLELTNQLDKSVQLTWTPGDDNNSPITKFIIEYEDAMHEAGLWRH- 700

  Fly   966 DRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEA-VTIITAEEAPSGKP---QNIKVE 1026
             :..|.|..|.||: ||||...|:.|::|||:||.|..||| ...:|....|...|   :.:..|
  Rat   701 -QAEVSGTQTTAQL-KLSPYVNYSFRVMAENSIGRSVPSEASEQYLTKAAEPDQNPTAVEGLGTE 763

  Fly  1027 PVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLRVYT 1091
            |.|   :.:||||....:.||..|.|.|.::..:.:..:....:..:::      ..:.....:.
  Rat   764 PDN---LVITWKPLNGFQSNGPGLQYKVSWRQKDGDDEWTSVVVANVSK------YIVSGTPTFV 819

  Fly  1092 QYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLESANGVIKT 1156
            .|.:.:||.|.:|..|........:.|..|...|.:...:.:.|......|...|.:|..|.::.
  Rat   820 PYLIKVQALNDVGFAPEPAAVMGHSGEDLPMVAPGNVRVSVVNSTLAEAHWDPVPPKSVRGHLQG 884

  Fly  1157 YKVVYAPSDEWYDETKRHYKKT------ASSDTVLHGLKKYTNYTMQVLATTAGGDGVRSVPIHC 1215
            |::.|..:.......:||.:|.      :.:..:|.||:.|::|.:.|......|:|..|.....
  Rat   885 YRIYYWKAQSSSKRNRRHIEKKILTFQGSKTHGMLPGLQPYSHYVLNVRVVNGKGEGPASADRGF 949

  Fly  1216 QTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETE---TKTQKVPHYQ 1277
            .|...||.||:.:|.:.....::.:.|.||:.||||:|:|.:..:...:..|   ....|:|..:
  Rat   950 HTPEGVPSAPSSLKIVNPTLDSLTLEWDPPSHPNGILTEYILKYQPINSTHELGPLVDLKIPANK 1014

  Fly  1278 MSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDTFTATFKEDAKMPCL 1342
            ..:....|..:..|:|:..|.|::|.|.|                  ..:....|..|..|    
  Rat  1015 TRWTLKNLNFSTRYKFYFYAQTSVGSGSQ------------------ITEEAITTVDEGKK---- 1057

  Fly  1343 AVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYSCHAENSIAKDSITHKLIVL 1407
             .|...|::                    |:..:::|:                           
  Rat  1058 -AGILPPDV--------------------GAGKVRAVS--------------------------- 1074

  Fly  1408 APPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKPEFG------EWETSEVSVDSQKHN 1466
              |:..:||.:|..|.| .:..: :||   |.|   :.:..|:|      ||....|:.......
  Rat  1075 --PRIGNVTAAAAETYA-NISWE-YEG---PEH---VKFYVEYGVAGSKEEWRKEIVNGSRSFFG 1129

  Fly  1467 IEGLLCGSRYQVYATGFNNIGAGEASDILNT 1497
            ::||:.|:.|:|......:.|...:.|:..|
  Rat  1130 LKGLMPGTAYKVRVGAEGDSGFVSSEDVFET 1160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 IgI_1_Dscam 38..136 CDD:409547 33/110 (30%)
Ig strand A 39..42 CDD:409547 1/3 (33%)
Ig strand A' 48..52 CDD:409547 1/3 (33%)
Ig strand B 55..64 CDD:409547 2/8 (25%)
Ig strand C 70..76 CDD:409547 1/5 (20%)
Ig strand C' 78..81 CDD:409547 2/10 (20%)
Ig strand D 87..90 CDD:409547 0/2 (0%)
Ig strand E 95..100 CDD:409547 1/4 (25%)
Ig strand F 113..121 CDD:409547 4/7 (57%)
Ig strand G 124..136 CDD:409547 4/11 (36%)
IgI_2_Dscam 246..343 CDD:409545 13/96 (14%)
Ig strand A 247..250 CDD:409545 1/2 (50%)
Ig strand A' 260..264 CDD:409545 1/3 (33%)
Ig strand B 267..274 CDD:409545 2/6 (33%)
Ig strand C 282..288 CDD:409545 0/5 (0%)
Ig strand C' 294..297 CDD:409545 0/2 (0%)
Ig strand D 303..307 CDD:409545 0/3 (0%)
Ig strand E 309..315 CDD:409545 0/5 (0%)
Ig strand F 322..330 CDD:409545 1/7 (14%)
Ig strand G 333..343 CDD:409545 1/9 (11%)
IgC2_3_Dscam 346..426 CDD:409549 14/79 (18%)
Ig strand A 347..352 CDD:409549 2/4 (50%)
Ig strand A' 355..359 CDD:409549 1/3 (33%)
Ig strand B 362..372 CDD:409549 1/9 (11%)
Ig strand C 377..383 CDD:409549 0/5 (0%)
Ig strand C' 384..387 CDD:409549 0/2 (0%)
Ig strand E 392..398 CDD:409549 0/5 (0%)
Ig strand F 405..413 CDD:409549 1/7 (14%)
Ig strand G 416..426 CDD:409549 0/9 (0%)
IgI_4_Dscam 432..527 CDD:409548 25/95 (26%)
Ig strand A 432..435 CDD:409548 0/2 (0%)
Ig strand A' 441..445 CDD:409548 0/3 (0%)
Ig strand B 448..457 CDD:409548 2/8 (25%)
Ig strand C 462..468 CDD:409548 3/6 (50%)
Ig strand C' 470..473 CDD:409548 1/2 (50%)
Ig strand D 478..486 CDD:409548 1/7 (14%)
Ig strand E 490..499 CDD:409548 2/8 (25%)
Ig strand F 506..514 CDD:409548 5/7 (71%)
Ig strand G 517..527 CDD:409548 2/9 (22%)
IgI_5_Dscam 531..618 CDD:409550 25/92 (27%)
Ig strand A 531..533 CDD:409550 2/2 (100%)
Ig strand A' 538..542 CDD:409550 0/3 (0%)
Ig strand B 545..552 CDD:409550 1/6 (17%)
Ig strand C 559..565 CDD:409550 2/5 (40%)
Ig strand C' 566..568 CDD:409550 0/1 (0%)
Ig strand D 575..579 CDD:409550 1/3 (33%)
Ig strand E 582..588 CDD:409550 1/5 (20%)
Ig strand F 596..604 CDD:409550 4/7 (57%)
Ig strand G 608..618 CDD:409550 2/9 (22%)
Ig 621..718 CDD:472250 6/96 (6%)
Ig strand B 639..643 CDD:409353 0/3 (0%)
Ig strand C 653..657 CDD:409353 0/3 (0%)
Ig strand E 684..688 CDD:409353 0/3 (0%)
Ig strand F 698..703 CDD:409353 0/4 (0%)
Ig strand G 711..714 CDD:409353 1/2 (50%)
IgI_7_Dscam 721..815 CDD:409546 23/95 (24%)
Ig strand A 721..725 CDD:409546 1/3 (33%)
Ig strand A' 730..734 CDD:409546 0/3 (0%)
Ig strand B 737..746 CDD:409546 2/8 (25%)
Ig strand C 752..758 CDD:409546 1/5 (20%)
Ig strand C' 764..767 CDD:409546 1/4 (25%)
Ig strand D 775..778 CDD:409546 0/2 (0%)
Ig strand E 780..786 CDD:409546 3/5 (60%)
Ig strand F 793..801 CDD:409546 4/7 (57%)
Ig strand G 806..815 CDD:409546 1/8 (13%)
Ig 818..916 CDD:472250 22/109 (20%)
Ig strand B 836..840 CDD:409353 0/3 (0%)
Ig strand C 849..853 CDD:409353 2/3 (67%)
Ig strand E 880..884 CDD:409353 1/3 (33%)
Ig strand F 894..899 CDD:409353 2/4 (50%)
FN3 <899..1212 CDD:442628 84/335 (25%)
Ig strand G 907..910 CDD:409353 2/4 (50%)
FN3 1222..1312 CDD:238020 24/92 (26%)
Ig <1339..1406 CDD:472250 4/66 (6%)
Ig strand C 1350..1354 CDD:409358 0/3 (0%)
Ig strand E 1372..1376 CDD:409358 1/3 (33%)
Ig strand F 1386..1391 CDD:409358 0/4 (0%)
Ig strand G 1399..1402 CDD:409358 0/2 (0%)
FN3 1409..1499 CDD:238020 23/95 (24%)
FN3 1504..1584 CDD:238020
Dscam_C 1893..2008 CDD:463546
NrcamXP_038968603.1 IgI_NrCAM 50..144 CDD:409458 33/114 (29%)
Ig strand A 50..54 CDD:409458 1/3 (33%)
Ig strand A' 59..63 CDD:409458 0/3 (0%)
Ig strand B 68..75 CDD:409458 3/14 (21%)
Ig strand C 81..86 CDD:409458 1/4 (25%)
Ig strand C' 89..91 CDD:409458 1/1 (100%)
Ig strand D 98..101 CDD:409458 1/2 (50%)
Ig strand E 106..110 CDD:409458 0/3 (0%)
Ig strand F 123..131 CDD:409458 4/7 (57%)
Ig strand G 134..144 CDD:409458 2/9 (22%)
Ig 153..242 CDD:472250 26/125 (21%)
Ig strand B 167..171 CDD:409353 1/3 (33%)
Ig strand C 181..185 CDD:409353 2/4 (50%)
Ig strand E 204..208 CDD:409353 2/3 (67%)
Ig strand F 219..224 CDD:409353 2/4 (50%)
Ig strand G 235..238 CDD:409353 1/12 (8%)
Ig 281..362 CDD:472250 30/131 (23%)
Ig strand B 292..296 CDD:409353 1/3 (33%)
Ig strand C 305..309 CDD:409353 1/3 (33%)
Ig strand E 327..331 CDD:409353 1/3 (33%)
Ig strand F 341..346 CDD:409353 2/4 (50%)
Ig strand G 354..357 CDD:409353 1/2 (50%)
Ig 366..454 CDD:472250 24/92 (26%)
Ig strand B 382..386 CDD:409353 0/3 (0%)
Ig strand C 395..399 CDD:409353 1/3 (33%)
Ig strand E 419..423 CDD:409353 1/3 (33%)
Ig strand F 433..438 CDD:409353 2/4 (50%)
Ig strand G 446..449 CDD:409353 0/2 (0%)
Ig 460..546 CDD:472250 28/142 (20%)
Ig strand B 476..480 CDD:409353 1/3 (33%)
Ig strand C 489..493 CDD:409353 0/3 (0%)
Ig strand E 512..516 CDD:409353 3/3 (100%)
Ig strand F 526..531 CDD:409353 2/4 (50%)
Ig strand G 539..542 CDD:409353 0/2 (0%)
Ig 553..637 CDD:472250 20/93 (22%)
Ig strand B 567..571 CDD:409353 0/3 (0%)
Ig strand C 582..586 CDD:409353 2/3 (67%)
Ig strand E 604..607 CDD:409353 1/2 (50%)
Ig strand F 617..622 CDD:409353 2/4 (50%)
Ig strand G 630..633 CDD:409353 1/2 (50%)
FN3 651..741 CDD:238020 36/92 (39%)
fn3 754..836 CDD:394996 18/90 (20%)
fn3 852..944 CDD:394996 19/91 (21%)
FN3 <920..>1154 CDD:442628 62/313 (20%)
fn3 957..1041 CDD:394996 21/83 (25%)
Bravo_FIGEY 1198..1287 CDD:464016
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.