DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and Ptp99A

DIOPT Version :10

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:NP_651691.4 Gene:Ptp99A / 43469 FlyBaseID:FBgn0004369 Length:1397 Species:Drosophila melanogaster


Alignment Length:855 Identity:201/855 - (23%)
Similarity:338/855 - (39%) Gaps:155/855 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   830 ARRGEPAVLQCEAKGEKPI--GILWNMNNMRLDPKNDNR----YTIREEILST--GVMSSLSIKR 886
            |..|:...:.|....|..:  .::|...:..: .:..||    ::.|.::||.  |:..|.|:  
  Fly    50 AEAGKNVTIPCPGVNEHSLVDTLVWKTASTTI-AQFANRIPLLHSPRIQLLSDNFGLQFSPSL-- 111

  Fly   887 TERSDSALFTCVATNAFGSDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWA-QPYDGNSPLDR 950
              .||::.:.|: .|.....:|.::::||:||:.|....::..:.|||.|||| ..:..|:|:..
  Fly   112 --ASDTSEYICL-VNDRHIPEAIVDLLVQDVPDPPERPLLISFTSRSVNLSWAHSQHPRNAPVTH 173

  Fly   951 YIIEFKRSR-ASWSEIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTS-QSSEAVTIITAE 1013
            :|||.:... ..|.::.|:....:.|..||..|:|.|.|:.|::|.|.:|.| .|.|:..|:|..
  Fly   174 FIIETREGEDGIWEQLARIYTKTNATSYQVTGLTPFTVYSFRLLAVNKLGISPPSKESYYIVTLR 238

  Fly  1014 EAPSGKPQNIKVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGK 1078
            |||:|||........:.|::.::||.||.....||.|||.:.|:..:.:.:   :|......:..
  Fly   239 EAPTGKPIPTTAHNTSSTSVYISWKAPPPDTILGEFLGYRITYRPRDRDPN---DTKEIYIRDNT 300

  Fly  1079 EHNLELQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWV 1143
            ..:.|:|||:.||||.|.:|.||..|.|| .......|.||.||:|.:.| ...:::.:|.:.| 
  Fly   301 VESHEIQNLQTYTQYKVTVQVFNPEGLGP-ETTILVMTDEGVPSKPQNLT-ILDVSANSITMSW- 362

  Fly  1144 SPPLESANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLH----GLKKYTNYTMQVLATTAG 1204
            .|| ::.||.|..|.|.:...::...|..::.:.  |.:|::|    .|:.||:|.:.|.|.|..
  Fly   363 HPP-KNQNGAIAGYHVFHIHDNQTGVEIVKNSRN--SVETLIHFELQNLRPYTDYRVIVKAFTTK 424

  Fly  1205 GDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETETK 1269
            .:|..|..|..:|:...|.||..|........:|.:.||.|.:....|..|.:.::..|.:|.. 
  Fly   425 NEGEPSDQIAQRTDVGGPSAPAIVNLTCHSQESITIRWRRPYEFYNTIDFYIIKTRLAGQDTHR- 488

  Fly  1270 TQKVPHYQMSFEATELE---------KNKPYEFWVTAST---------TIGEGQQSKSIVAMPS- 1315
                 ..:::..|.|||         .|..||..|.|:|         .:|:..:|:.|...|: 
  Fly   489 -----DIRINASAKELETAMILQNLTTNSYYEVKVAAATFSVINPKKIVLGKFSESRIIQLQPNC 548

  Fly  1316 DQVPAKIASFDDTFTATFKEDAKMPCLAV-----------------------GAPQ----PEITW 1353
            :::...:....:.:...........|..:                       ..|.    |::.|
  Fly   549 EKLQPLLRQSHNDYNLAVLVGIIFSCFGIILIIMAFFLWSRKCFHAAYYYLDDPPHHPNAPQVDW 613

  Fly  1354 KIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYSCHAENSIA----KDSITHKLIV--LAPPQS 1412
            :   |.....|.:|.....:...|.|       .|.||:..|.    .::|.::.|.  |....|
  Fly   614 E---VPVKIGDEIRAAVPVNEFAKHV-------ASLHADGDIGFSREYEAIQNECISDDLPCEHS 668

  Fly  1413 PHVT-------LSATTTDALTVKLKPHEGDTAPL--------HGY--------TLHYKPEFGE-- 1452
            .|..       |:.|..|...|.|.|..|....|        .||        |....|:..:  
  Fly   669 QHPENKRKNRYLNITAYDHSRVHLHPTPGQKKNLDYINANFIDGYQKGHAFIGTQGPLPDTFDCF 733

  Fly  1453 ----WE---------TSEVSVDSQKHNI----EGLLCGSRYQVYATGFNNIGAGEASDILNTRTK 1500
                ||         |:.|....:|.::    :|:      :.|......:...|.......||.
  Fly   734 WRMIWEQRVAIIVMITNLVERGRRKCDMYWPKDGV------ETYGVIQVKLIEEEVMSTYTVRTL 792

  Fly  1501 GQKPKLPEKPRFIEVSSNSVSLHFKAWKDGG-----CPMSHFVVESKKRDQIEWNQI----SNNV 1556
            ..|....:|.:...........|:..|.|.|     .|:.:||.:|...:..|...|    |..|
  Fly   793 QIKHLKLKKKKQCNTEKLVYQYHYTNWPDHGTPDHPLPVLNFVKKSSAANPAEAGPIVVHCSAGV 857

  Fly  1557 KPDNNYVVLD 1566
            .....|:|||
  Fly   858 GRTGTYIVLD 867

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 IgI_1_Dscam 38..136 CDD:409547
Ig strand A 39..42 CDD:409547
Ig strand A' 48..52 CDD:409547
Ig strand B 55..64 CDD:409547
Ig strand C 70..76 CDD:409547
Ig strand C' 78..81 CDD:409547
Ig strand D 87..90 CDD:409547
Ig strand E 95..100 CDD:409547
Ig strand F 113..121 CDD:409547
Ig strand G 124..136 CDD:409547
IgI_2_Dscam 246..343 CDD:409545
Ig strand A 247..250 CDD:409545
Ig strand A' 260..264 CDD:409545
Ig strand B 267..274 CDD:409545
Ig strand C 282..288 CDD:409545
Ig strand C' 294..297 CDD:409545
Ig strand D 303..307 CDD:409545
Ig strand E 309..315 CDD:409545
Ig strand F 322..330 CDD:409545
Ig strand G 333..343 CDD:409545
IgC2_3_Dscam 346..426 CDD:409549
Ig strand A 347..352 CDD:409549
Ig strand A' 355..359 CDD:409549
Ig strand B 362..372 CDD:409549
Ig strand C 377..383 CDD:409549
Ig strand C' 384..387 CDD:409549
Ig strand E 392..398 CDD:409549
Ig strand F 405..413 CDD:409549
Ig strand G 416..426 CDD:409549
IgI_4_Dscam 432..527 CDD:409548
Ig strand A 432..435 CDD:409548
Ig strand A' 441..445 CDD:409548
Ig strand B 448..457 CDD:409548
Ig strand C 462..468 CDD:409548
Ig strand C' 470..473 CDD:409548
Ig strand D 478..486 CDD:409548
Ig strand E 490..499 CDD:409548
Ig strand F 506..514 CDD:409548
Ig strand G 517..527 CDD:409548
IgI_5_Dscam 531..618 CDD:409550
Ig strand A 531..533 CDD:409550
Ig strand A' 538..542 CDD:409550
Ig strand B 545..552 CDD:409550
Ig strand C 559..565 CDD:409550
Ig strand C' 566..568 CDD:409550
Ig strand D 575..579 CDD:409550
Ig strand E 582..588 CDD:409550
Ig strand F 596..604 CDD:409550
Ig strand G 608..618 CDD:409550
Ig 621..718 CDD:472250
Ig strand B 639..643 CDD:409353
Ig strand C 653..657 CDD:409353
Ig strand E 684..688 CDD:409353
Ig strand F 698..703 CDD:409353
Ig strand G 711..714 CDD:409353
IgI_7_Dscam 721..815 CDD:409546
Ig strand A 721..725 CDD:409546
Ig strand A' 730..734 CDD:409546
Ig strand B 737..746 CDD:409546
Ig strand C 752..758 CDD:409546
Ig strand C' 764..767 CDD:409546
Ig strand D 775..778 CDD:409546
Ig strand E 780..786 CDD:409546
Ig strand F 793..801 CDD:409546
Ig strand G 806..815 CDD:409546
Ig 818..916 CDD:472250 19/93 (20%)
Ig strand B 836..840 CDD:409353 0/3 (0%)
Ig strand C 849..853 CDD:409353 0/3 (0%)
Ig strand E 880..884 CDD:409353 1/3 (33%)
Ig strand F 894..899 CDD:409353 1/4 (25%)
FN3 <899..1212 CDD:442628 99/319 (31%)
Ig strand G 907..910 CDD:409353 1/2 (50%)
FN3 1222..1312 CDD:238020 25/107 (23%)
Ig <1339..1406 CDD:472250 14/97 (14%)
Ig strand C 1350..1354 CDD:409358 0/3 (0%)
Ig strand E 1372..1376 CDD:409358 0/3 (0%)
Ig strand F 1386..1391 CDD:409358 1/4 (25%)
Ig strand G 1399..1402 CDD:409358 1/2 (50%)
FN3 1409..1499 CDD:238020 22/131 (17%)
FN3 1504..1584 CDD:238020 17/72 (24%)
Dscam_C 1893..2008 CDD:463546
Ptp99ANP_651691.4 FN3 140..236 CDD:238020 31/95 (33%)
FN3 243..337 CDD:238020 30/97 (31%)
fn3 343..430 CDD:394996 24/91 (26%)
FN3 442..520 CDD:238020 20/83 (24%)
R5-PTPc-1 704..907 CDD:350397 32/170 (19%)
R5-PTP-2 989..1182 CDD:350398
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.