DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and dpr10

DIOPT Version :9

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:341 Identity:70/341 - (20%)
Similarity:119/341 - (34%) Gaps:107/341 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 GMYQCFVR-----NDQESAEAS------AELKLGGRFDPPVIRQAFQEE-TMEPGPSVFLKCVAG 457
            |:..|:.|     |:..:|||.      :....|.:::.|......... |...|.|.:|.|...
  Fly    14 GLAVCYQRQSVSNNNHNNAEAKPTHAPPSHYPHGHKWNEPYFDLTMPRNITSLVGKSAYLGCRVK 78

  Fly   458 --GNPTPEISWELDGKKIANNDRY--QVGQY---------VTVNGDVVSY-LNITSVHANDGGLY 508
              ||.|  ::|      |.:.|.:  .||.|         .:.:.|:..: |.|......|.|:|
  Fly    79 HLGNKT--VAW------IRHRDLHILTVGTYTYTTDQRFQTSYHRDIDEWTLQIKWAQQRDAGVY 135

  Fly   509 KCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGETLIVTCPVAGYPIDSIVWERDNRALPIN 573
            :|...:: .|..:|..||:..|           :..||..:                        
  Fly   136 ECQISTQ-PVRSYSVNLNIVDL-----------IDAETSDI------------------------ 164

  Fly   574 RKQKVFPNGTLIIENVERNSDQATYTCVAKNQEGYSARGSL-----EVQVMVLPQIVPFAYEDL- 632
             .|:.:             :|.|.|  :|:|:...|:....     .:|.:.:|........|| 
  Fly   165 -MQQYY-------------NDDAFY--IAENRVYQSSNDEFAGMFGPIQTVAVPTATILGGPDLY 213

  Fly   633 INMGDSIDLFCQIQ-KGDRPIKVHW-------SFERSAGDYGFDQVQPQMRTNRISEKTSMISIP 689
            ::.|.:|:|.|.|: ..:.|..:.|       |.|.|.|...|       :|.:..|..|::.|.
  Fly   214 VDKGSTINLTCIIKFSPEPPTHIFWYHQDKVLSEETSGGRLKF-------KTIKSEETKSILLIY 271

  Fly   690 SASPAHTGRDTCIASN 705
            .|...|:|:.:|..||
  Fly   272 DADLLHSGKYSCYPSN 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653
Ig 269..340 CDD:143165
IG_like 353..425 CDD:214653 7/30 (23%)
IGc2 361..413 CDD:197706 3/12 (25%)
I-set 433..527 CDD:254352 25/108 (23%)
IGc2 446..517 CDD:197706 20/84 (24%)
I-set 533..618 CDD:254352 9/89 (10%)
IGc2 544..607 CDD:197706 8/62 (13%)
Ig 641..714 CDD:143165 20/73 (27%)
IGc2 735..804 CDD:197706
I-set 819..914 CDD:254352
Ig 833..921 CDD:299845
FN3 918..1011 CDD:238020
FN3 1018..1116 CDD:238020
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
dpr10NP_729591.1 Ig 63..143 CDD:299845 21/88 (24%)
IG_like 210..297 CDD:214653 24/85 (28%)
IGc2 217..287 CDD:197706 20/76 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.