DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and ImpL2

DIOPT Version :9

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:NP_728961.2 Gene:ImpL2 / 38513 FlyBaseID:FBgn0001257 Length:267 Species:Drosophila melanogaster


Alignment Length:365 Identity:65/365 - (17%)
Similarity:107/365 - (29%) Gaps:157/365 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LMLFAAVALIACGSQTL------AANPPDADQKGP----------VFLKEPTNRIDFSNSTGAEI 59
            |:||.::|.:...:..|      ..|..:|:::.|          .|.|.|..::..::....||
  Fly    14 LLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNRAFEADWLKFTKTPPTKLQQADGATIEI 78

  Fly    60 ECKASGNPMPEIIWIRSDGTAVGDVP-------GLRQISSDGKLVFPPFRAEDYRQEV--HAQVY 115
            .|:..|:.:|.|.|:      ||.:|       ...|::.:........|:......|  .|:.|
  Fly    79 VCEMMGSQVPSIQWV------VGHLPRSELDDLDSNQVAEEAPSAIVRVRSSHIIDHVLSEARTY 137

  Fly   116 ACLARNQFGSIISRDVHVRAVVSQHYEEDIHKAFVIRGNSAILKCDIPSFVADFVNVISWHSDEK 180
            .|:.|..     |:.::...||                                      |....
  Fly   138 TCVGRTG-----SKTIYASTVV--------------------------------------HPPRS 159

  Fly   181 ENFYPGTEYDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVGSV 245
            ....|...|.|                                       |.|.|::.||     
  Fly   160 SRLTPEKTYPG---------------------------------------AQKPRIIYTE----- 180

  Fly   246 SPQLSGNGNQEHITLTRVPKMGS-VTLMCPAQAYPVPFFRWYKFIEGTTRKQAVVLNDRVKQV-- 307
                     :.|:.|     ||| :.|.|...|.|.....|              ||:..|::  
  Fly   181 ---------KTHLDL-----MGSNIQLPCRVHARPRAEITW--------------LNNENKEIVQ 217

  Fly   308 --------SGTLIIKDAVVEDSGKYLCVVNNSVGGESVET 339
                    :|.|:|.:...||.|.|.|:..|.||.::.:|
  Fly   218 GHRHRVLANGDLLISEIKWEDMGNYKCIARNVVGKDTADT 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 Ig 38..130 CDD:299845 22/110 (20%)
IG 57..133 CDD:214652 18/84 (21%)
IG_like 267..343 CDD:214653 22/84 (26%)
Ig 269..340 CDD:143165 20/81 (25%)
IG_like 353..425 CDD:214653
IGc2 361..413 CDD:197706
I-set 433..527 CDD:254352
IGc2 446..517 CDD:197706
I-set 533..618 CDD:254352
IGc2 544..607 CDD:197706
Ig 641..714 CDD:143165
IGc2 735..804 CDD:197706
I-set 819..914 CDD:254352
Ig 833..921 CDD:299845
FN3 918..1011 CDD:238020
FN3 1018..1116 CDD:238020
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
ImpL2NP_728961.2 IGc2 187..251 CDD:197706 20/77 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.