DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and DIP-iota

DIOPT Version :9

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster


Alignment Length:367 Identity:88/367 - (23%)
Similarity:127/367 - (34%) Gaps:111/367 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 TVDFGRPAVFTCQYTGNPIKTVSWMK-DGK----------------AIGHSEP---VLRIESVKK 401
            ||..||.|:.||.........|:|:: |.:                :|.|:|.   .|:|..|::
  Fly    41 TVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRISISHTEHRIWQLKIRDVQE 105

  Fly   402 EDKGMYQCFVRNDQESAEASAELKLGGRFD---PP--VIRQAFQEETMEPGPSVFLKCVAGGNPT 461
            .|:|.|.|.:..|...::.       |..|   ||  |..|..|:.....|.:|.|.|.|.|.|.
  Fly   106 SDRGWYMCQINTDPMKSQM-------G
YLDVVVPPDIVDYQTSQDVVRSTGQNVTLTCSATGVPM 163

  Fly   462 PEISWEL----------DGKKIANNDRYQVGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKV 516
            |.|:|..          ||      ||    :..:|.|   ..|.:..|..:..|.|.|||.:  
  Fly   164 PTITWRREEATPILISDDG------DR----EVFSVEG---QNLTLWQVQRSHMGAYLCIASN-- 213

  Fly   517 GVAEHSAK---LNVYGLPYI-RQMEKKAIVAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQK 577
            ||....:|   |.|...|.| .:.:...:..|:.|.:.|.....|.....|.||::.|.....:.
  Fly   214 GVPPTVSKRVMLVV
NFAPTIWTRYDTIYVGLGQKLTLECITESQPASVNFWLRDSQLLQGGSYES 278

  Fly   578 VFPNGTLIIENVER-----------NSDQATYTCVAKNQEGYSAR------------------GS 613
            |      .:::|.|           ..|...|.|.|||..|.:.|                  .|
  Fly   279 V------SVDHVFRIVMRITLRPITKRDFGEYICRAKNAMGQTDRIITVHHKAKKHGQHSHQTSS 337

  Fly   614 LEVQVMVLPQIVPFAYEDLINMGDS--------IDLFCQIQK 647
            .|.|.:|:.       |.:.||.|.        |...|.:.|
  Fly   338 RESQFIVIE-------EYIANMSDKSCSFQPLWIMFLCFVNK 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653
Ig 269..340 CDD:143165
IG_like 353..425 CDD:214653 21/87 (24%)
IGc2 361..413 CDD:197706 18/71 (25%)
I-set 433..527 CDD:254352 31/108 (29%)
IGc2 446..517 CDD:197706 23/80 (29%)
I-set 533..618 CDD:254352 22/114 (19%)
IGc2 544..607 CDD:197706 17/73 (23%)
Ig 641..714 CDD:143165 2/7 (29%)
IGc2 735..804 CDD:197706
I-set 819..914 CDD:254352
Ig 833..921 CDD:299845
FN3 918..1011 CDD:238020
FN3 1018..1116 CDD:238020
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 21/90 (23%)
Ig 39..122 CDD:299845 21/80 (26%)
Ig 132..213 CDD:299845 28/93 (30%)
IG_like 141..227 CDD:214653 28/100 (28%)
IG_like 239..322 CDD:214653 19/88 (22%)
IGc2 245..313 CDD:197706 17/73 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.