DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and DIP-theta

DIOPT Version :9

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:505 Identity:113/505 - (22%)
Similarity:181/505 - (35%) Gaps:157/505 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 FIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESV----ETVLTVTAPLS 348
            ||.|.:.:     :|.:......:..||.::||..:...|  |::..:.:    |.:..||.|:|
  Fly    87 FIIGESEE-----HDHIAHHLAEMQNKDELLEDIREDTVV--NAIPEKDLPKFGELLQNVTVPVS 144

  Fly   349 AKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMK-----------------DGKAIGHSEP---V 393
                         |.||..|.........::|::                 ...:|.|:|.   :
  Fly   145 -------------REAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEKRAWI 196

  Fly   394 LRIESVKKEDKGMYQCFVRNDQESAEASAELKLGGRFD---PP-----------VIRQAFQEETM 444
            |||..||:.|||.|.|.:..|...::.       |..|   ||           |||:       
  Fly   197 LRIRDVKESDKGWYMCQINTDPMKSQV-------GYLDVVVPPDILDYPTSTDMVIRE------- 247

  Fly   445 EPGPSVFLKCVAGGNPTPEISWELDGKK---IANNDRYQVGQYVTVNGDVVSYLNITSVHANDGG 506
              |.:|.|||.|.|:|||.|:|..:|.:   :.|.     .:.|..||   |:|.|..|:..:.|
  Fly   248 --GSNVTLKCAATGSPTPTITWRREGGELIPLPNG-----AEAVAYNG---SFLTIAKVNRLNMG 302

  Fly   507 LYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGETLIVT--CPVAGYPIDSIVW-ERDNR 568
            .|.|||.:.:........:.:...|.:..::.:.:.|..|..:|  |....||.....| :.|..
  Fly   303 AYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWMKNDTI 367

  Fly   569 ALPINR-KQKVFPNG-----TLIIENVERNSDQATYTCVAKNQEGYSARGSLE------------ 615
            .:|..| ..:.|.:|     .|.|..|: ..|...|.|||||..| ...|:::            
  Fly   368 IVPGERFVPETFESGYKITMRLTIYEVD-IQDFGAYRCVAKNSLG-DTDGAIKLYHIPQTTTMTT 430

  Fly   616 ----VQVMVLPQIV------------------PFAYEDLINMGDSIDLFCQIQKGDRPIKVHWSF 658
                |.:..:|.::                  |:.:    |.|:| ....::|:|          
  Fly   431 MAPTVSINTVPVVLVKYNKEQRYGSSQNSNTNPYNF----NPGNS-QQNTKLQRG---------- 480

  Fly   659 ERSAGDYGFDQVQPQMRTNRISEKTSMI---------SIPSASPAHTGRD 699
              .:...|.|| .|....|.....||.:         |..|:|.:..|||
  Fly   481 --KSNSKGSDQ-SPSGLNNVFVGATSSLWNSQDHHSSSSSSSSASSRGRD 527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653 11/58 (19%)
Ig 269..340 CDD:143165 11/55 (20%)
IG_like 353..425 CDD:214653 19/91 (21%)
IGc2 361..413 CDD:197706 18/71 (25%)
I-set 433..527 CDD:254352 30/107 (28%)
IGc2 446..517 CDD:197706 26/73 (36%)
I-set 533..618 CDD:254352 25/109 (23%)
IGc2 544..607 CDD:197706 21/71 (30%)
Ig 641..714 CDD:143165 15/68 (22%)
IGc2 735..804 CDD:197706
I-set 819..914 CDD:254352
Ig 833..921 CDD:299845
FN3 918..1011 CDD:238020
FN3 1018..1116 CDD:238020
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 25/112 (22%)
IG_like 137..230 CDD:214653 25/112 (22%)
IG_like 240..324 CDD:214653 29/100 (29%)
IGc2 247..310 CDD:197706 26/79 (33%)
Ig 327..419 CDD:299845 25/93 (27%)
IG_like 343..420 CDD:214653 22/78 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.