DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and dpr3

DIOPT Version :9

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster


Alignment Length:519 Identity:94/519 - (18%)
Similarity:164/519 - (31%) Gaps:163/519 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   956 KRSRASWSEIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIG----TSQSSEAVTII------ 1010
            :||.|...::.....|||..:..|...:...|.::...|..|..    .:.::.||.||      
  Fly    49 RRSGADDVDVIEPRSPGHAADVDVAAAAAGATTSVAATAAAAAAATTRAAATTRAVIIIMALVVS 113

  Fly  1011 -----------------TAEEAPSGKPQNIKVEPVNQTTMRVTWK---PPPRTEWN----GEILG 1051
                             .|..|.:|:|.:....|...|.:..:..   .||....:    .....
  Fly   114 IMQQQQQSLLWPFCNGLAAAAASTGQPDDSGDGPTLSTFLSSSQSQSPSPPAASASASSPSSFSS 178

  Fly  1052 YYVGYKLSNTNSSYVFETINFI-----------TEEGKEHNLELQNLRVYTQYSVVIQAFNKIGA 1105
            :.|.:......:::.|:::.|:           |:..:|.:                      ||
  Fly   179 FAVAHGPQTEATNHTFKSLAFLDASFGSDLFAQTDAKRERS----------------------GA 221

  Fly  1106 GPLSEEEKQ--FTAEGTP----SQPPSDTACTTLTSQTIRVGWVSPPLESANGVIKTYKVVYAPS 1164
               ::||.|  .|::..|    ..|.:.|..|..|...|:....|...:|.:.:.|....:....
  Fly   222 ---ADEESQDADTSQSLPIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVG 283

  Fly  1165 DEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGVRSVPIHCQ--TEP-------- 1219
            ...|...|| ::.|.|.|:        ..:|:.|.|..|...|:    ..||  |||        
  Fly   284 TATYTSDKR-FQVTESKDS--------REWTLHVKAPLAKDSGI----YECQVNTEPKMSMAFQL 335

  Fly  1220 DVPEAPTDVKALVMG--------NAAILVS---WRPPAQPNGIITQYTVYSKAEGAETETKTQKV 1273
            ::.|...|.||::.|        .:||:::   .:|..:..|.|..|                :.
  Fly   336 NIIEISPDAKAVISGPPDLHFKAGSAIILNCLVQQPSVKDIGPIYWY----------------RG 384

  Fly  1274 PHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDTFTATFKEDAK 1338
            .|....|:|.:.:...|          .|.|:..:.|   |.|..|..|.|..|.          
  Fly   385 EHMITPFDADDGQPEIP----------AGRGEHPQGI---PEDTSPNDIMSEVDL---------- 426

  Fly  1339 MPCLAVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYSCHAENSIAKDSITH 1402
                     |.|...:| .:|....|.::    ..|.|.:....|.|:|:|....:.:...:.|
  Fly   427 ---------QMEFATRI-AMESQLGDTLK----SRLRISNAQTTDTGNYTCQPTTASSASVLVH 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653
Ig 269..340 CDD:143165
IG_like 353..425 CDD:214653
IGc2 361..413 CDD:197706
I-set 433..527 CDD:254352
IGc2 446..517 CDD:197706
I-set 533..618 CDD:254352
IGc2 544..607 CDD:197706
Ig 641..714 CDD:143165
IGc2 735..804 CDD:197706
I-set 819..914 CDD:254352
Ig 833..921 CDD:299845
FN3 918..1011 CDD:238020 14/81 (17%)
FN3 1018..1116 CDD:238020 16/117 (14%)
FN3 1124..1217 CDD:238020 21/94 (22%)
FN3 1222..1312 CDD:238020 18/100 (18%)
Ig 1339..1406 CDD:299845 12/64 (19%)
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
dpr3NP_001014459.2 Ig 243..330 CDD:299845 24/99 (24%)
IG_like 243..329 CDD:214653 24/98 (24%)
Ig 350..464 CDD:299845 30/166 (18%)
IG_like <441..477 CDD:214653 8/40 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.