DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and CG33543

DIOPT Version :9

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:434 Identity:100/434 - (23%)
Similarity:152/434 - (35%) Gaps:85/434 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   622 PQIVPFAYEDLINMGDSIDLFCQIQKGDRPIKVHWSFERSAGDYGFDQVQPQMRTN-----RISE 681
            |.|..|..|..|       :|||..:.|  |...|...|.           |.|.|     .|.:
  Fly    55 PSITHFVNESFI-------IFCQTVQKD--IDTKWRDPRG-----------QTRENTKGRVHIEK 99

  Fly   682 KTS---MISIPSASPAHTGRDTC-IASNKAGTTTYSV--------DLTVNVPPRWILEPTDKAFA 734
            ||:   .:.....:....|..|| :..|:.|....:|        :|.||....:......::..
  Fly   100 KTTGLLALVFEHIALEDRGNWTCEVNGNRNGNRNVNVEREFLASFELLVNQKISFGKTEQVQSVR 164

  Fly   735 QGSDAKVECKADGFPKPQVTWKKAVGDTPGEY-KDLKKSDNIRVEEGTLHVDNIQKTNEGYYLCE 798
            :|.||.|.|..:|.|.|:|:|.     ..||| ..:..:.:.|:..| |::.|:.:.:.|.|.|.
  Fly   165 EGRDAMVNCFVEGMPAPEVSWL-----YNGEYINTVNSTKHNRLSNG-LYIRNVSQADAGEYTCR 223

  Fly   799 AIN---GIGSGLSAVIMISVQAPPE--FTEKLRNQTARRGEPAVLQCEAKGEKPIGILWNMNNMR 858
            |:.   .........|::.:|..|.  |.|.|..|.|..|....|.|:|.||.|....|..||..
  Fly   224 AMRITPTFSDSDQITILLRIQHKPHWFFNETLPVQYAYVGGAVNLSCDAMGEPPPSFTWLHNNKG 288

  Fly   859 LDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDASINMIVQEVPEMP-- 921
            :...|       ..|......::|.::....|....:.|...|..|..:..|.:.....|..|  
  Fly   289 IVGFN-------HRIFVADYGATLQLQMKNASQFGDYKCKVANPLGMLERVIKLRPGPKPLGPRR 346

  Fly   922 YALKVLDKSGRSVQLSWAQPYDGNSPLDRY--------IIEFKRSRASWSEIDR----------V 968
            :.||.|..:|..:.:...:..:.:..:..|        ..|||.|..:||...:          .
  Fly   347 FQLKKLYTNGFELDIQTPRMSNVSDEMQIYGYRVAYMSDTEFKFSAGNWSYAKQRDFSFHGGKHF 411

  Fly   969 IVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITA 1012
            |:|         .|...|||.:|..:.|..|.|..|......||
  Fly   412 IIP---------HLETNTTYLMRAASRNLAGLSDWSPVKVFTTA 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653
Ig 269..340 CDD:143165
IG_like 353..425 CDD:214653
IGc2 361..413 CDD:197706
I-set 433..527 CDD:254352
IGc2 446..517 CDD:197706
I-set 533..618 CDD:254352
IGc2 544..607 CDD:197706
Ig 641..714 CDD:143165 18/81 (22%)
IGc2 735..804 CDD:197706 21/72 (29%)
I-set 819..914 CDD:254352 24/96 (25%)
Ig 833..921 CDD:299845 19/87 (22%)
FN3 918..1011 CDD:238020 24/112 (21%)
FN3 1018..1116 CDD:238020
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 20/64 (31%)
IG_like 256..336 CDD:214653 20/86 (23%)
IGc2 263..327 CDD:197706 16/70 (23%)
FN3 341..445 CDD:238020 24/112 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.