DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and dpr4

DIOPT Version :9

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:344 Identity:77/344 - (22%)
Similarity:109/344 - (31%) Gaps:112/344 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 IECKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQV-----YACL 118
            ::|...|..:|...|         :.|           ...|:.....|:||.|.|     ..|.
  Fly    24 LDCGMVGGEVPPHYW---------ETP-----------YSQPYFDNSSRREVTATVGQAALLHCR 68

  Fly   119 ARNQFGSIIS----RDVHVRAVVSQHYEEDIHKAFVIRGNSAILKCDIPSFVADFVNVISWHSDE 179
            .||.....:|    ||:|:..|....|..|                      ..|.::.|..|||
  Fly    69 VRNLGDRAVSWIRKRDLHILTVGILTYTND----------------------QRFQSLHSEGSDE 111

  Fly   180 KENFYPGTEYDGKYLVLPSGELHIREVGPEDGYKSYQCR--TKHRLTGETRLSATKGRLVITEPV 242
                               ..|.|....|.|. .:|:|:  |:.:::...||:....|..|.   
  Fly   112 -------------------WTLRISSPQPRDS-GTYECQVSTEPKISQGFRLNVVVSRAKIL--- 153

  Fly   243 GSVSPQLSGNGNQEHITLTRVPKMGS-VTLMCPAQAYPVP--FFRWYK---FIEGTTRKQAVVLN 301
                      ||.|...     |.|| :.|.|.|...|||  |..|||   .:..:.|....|:.
  Fly   154 ----------GNAELFI-----KSGSDINLTCLAMQSPVPPSFIYWYKGKRVMNYSQRGGINVIT 203

  Fly   302 DRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVF 366
            :|..:.|..||.| |...|||.|.|..::|.....|..|:....|.:         :..|..:. 
  Fly   204 ERSTRTSKLLIAK-ATPADSGNYTCSPSSSDSASVVVHVINGEHPAA---------MQHGNSSA- 257

  Fly   367 TC----QYTGNPIKTVSWM 381
            ||    ..|..|....:||
  Fly   258 TCLRPLSSTSVPFVLATWM 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 Ig 38..130 CDD:299845 15/79 (19%)
IG 57..133 CDD:214652 17/82 (21%)
IG_like 267..343 CDD:214653 28/81 (35%)
Ig 269..340 CDD:143165 25/75 (33%)
IG_like 353..425 CDD:214653 7/33 (21%)
IGc2 361..413 CDD:197706 7/25 (28%)
I-set 433..527 CDD:254352
IGc2 446..517 CDD:197706
I-set 533..618 CDD:254352
IGc2 544..607 CDD:197706
Ig 641..714 CDD:143165
IGc2 735..804 CDD:197706
I-set 819..914 CDD:254352
Ig 833..921 CDD:299845
FN3 918..1011 CDD:238020
FN3 1018..1116 CDD:238020
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
dpr4NP_001014616.2 V-set 53..146 CDD:284989 28/134 (21%)
IG_like 53..145 CDD:214653 28/133 (21%)
ig 153..227 CDD:278476 28/92 (30%)
IG_like 161..>227 CDD:214653 25/66 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.