| Sequence 1: | NP_001246162.1 | Gene: | Dscam1 / 35652 | FlyBaseID: | FBgn0033159 | Length: | 2038 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006510497.1 | Gene: | Opcml / 330908 | MGIID: | 97397 | Length: | 354 | Species: | Mus musculus |
| Alignment Length: | 291 | Identity: | 80/291 - (27%) |
|---|---|---|---|
| Similarity: | 126/291 - (43%) | Gaps: | 22/291 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 626 PFAYEDL-INMGDSIDLFCQIQKGDRPIKVHWSFERSAGDY-GFDQ--VQPQMRTNRISEKTSMI 686
Fly 687 SIPSASPAHTGRDTCIASNKAGTTTYSVDLTVNVPPRWILEPTDKAFAQGSDAKVECKADGFPKP 751
Fly 752 QVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQKTNEGYYLCEAINGIGSGLSAVIMISVQ 816
Fly 817 APPEFTEKLRNQTARRGEPAVLQCEAKGEKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSS 881
Fly 882 LSIKRTERSDSALFTCVATNAFGSDDASINM 912 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Dscam1 | NP_001246162.1 | Ig | 38..130 | CDD:299845 | |
| IG | 57..133 | CDD:214652 | |||
| IG_like | 267..343 | CDD:214653 | |||
| Ig | 269..340 | CDD:143165 | |||
| IG_like | 353..425 | CDD:214653 | |||
| IGc2 | 361..413 | CDD:197706 | |||
| I-set | 433..527 | CDD:254352 | |||
| IGc2 | 446..517 | CDD:197706 | |||
| I-set | 533..618 | CDD:254352 | |||
| IGc2 | 544..607 | CDD:197706 | |||
| Ig | 641..714 | CDD:143165 | 19/75 (25%) | ||
| IGc2 | 735..804 | CDD:197706 | 19/68 (28%) | ||
| I-set | 819..914 | CDD:254352 | 28/94 (30%) | ||
| Ig | 833..921 | CDD:299845 | 25/80 (31%) | ||
| FN3 | 918..1011 | CDD:238020 | |||
| FN3 | 1018..1116 | CDD:238020 | |||
| FN3 | 1124..1217 | CDD:238020 | |||
| FN3 | 1222..1312 | CDD:238020 | |||
| Ig | 1339..1406 | CDD:299845 | |||
| FN3 | 1409..1499 | CDD:238020 | |||
| FN3 | 1504..1584 | CDD:238020 | |||
| Dscam_C | 1890..2008 | CDD:289151 | |||
| Opcml | XP_006510497.1 | Ig | 44..132 | CDD:416386 | 23/90 (26%) |
| Ig strand A' | 44..49 | CDD:409353 | 0/4 (0%) | ||
| Ig strand B | 51..59 | CDD:409353 | 3/7 (43%) | ||
| CDR1 | 59..63 | CDD:409353 | 2/5 (40%) | ||
| FR2 | 64..70 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 64..70 | CDD:409353 | 2/6 (33%) | ||
| CDR2 | 71..83 | CDD:409353 | 5/11 (45%) | ||
| Ig strand C' | 72..76 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C' | 80..83 | CDD:409353 | 1/2 (50%) | ||
| FR3 | 84..118 | CDD:409353 | 6/33 (18%) | ||
| Ig strand D | 87..94 | CDD:409353 | 0/6 (0%) | ||
| Ig strand E | 97..103 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 110..118 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 119..123 | CDD:409353 | 0/3 (0%) | ||
| Ig strand G | 123..132 | CDD:409353 | 3/8 (38%) | ||
| FR4 | 125..132 | CDD:409353 | 3/6 (50%) | ||
| Ig_3 | 135..206 | CDD:404760 | 21/79 (27%) | ||
| Ig strand A | 135..138 | CDD:409353 | 2/2 (100%) | ||
| Ig strand A' | 144..148 | CDD:409353 | 1/3 (33%) | ||
| Ig strand B | 151..160 | CDD:409353 | 2/8 (25%) | ||
| Ig strand C | 165..170 | CDD:409353 | 3/4 (75%) | ||
| Ig strand C' | 171..174 | CDD:409353 | 0/2 (0%) | ||
| Ig strand F | 198..206 | CDD:409353 | 4/7 (57%) | ||
| Ig_3 | 223..300 | CDD:404760 | 23/82 (28%) | ||
| putative Ig strand A | 224..230 | CDD:409353 | 2/6 (33%) | ||
| Ig strand B | 240..244 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 253..257 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 279..283 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 293..298 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 306..309 | CDD:409353 | 1/2 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.900 | |||||