DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and Bsg

DIOPT Version :9

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:NP_723346.2 Gene:Bsg / 318841 FlyBaseID:FBgn0261822 Length:648 Species:Drosophila melanogaster


Alignment Length:164 Identity:40/164 - (24%)
Similarity:66/164 - (40%) Gaps:26/164 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   746 DGFPKPQVTWKK---AVGDTP---GEYKDLKKSDNIRVEEGTLHVDNIQKTNEGYYLCEAINGIG 804
            ||.|...:.|||   ||.|.|   |.:|       :..:|....:|.....::|.|.|| .:|:.
  Fly   430 DGTPGGVLIWKKNGTAVTDVPSLRGRFK-------LIADENKFIIDKTDTNDDGKYSCE-FDGVS 486

  Fly   805 SGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIGILWNMNNMRLDPKNDNRYTI 869
            ..:..:..:.|:.|       .|.....||...:.|...|.|| .:.|...|:.|....| |:.:
  Fly   487 KEIEVIARVVVRVP-------SNTAVVEGEKMSVTCSVVGTKP-ELTWTFANVTLTNATD-RFIL 542

  Fly   870 REEILSTGVMSS-LSIKRTERSDSALFTCVATNA 902
            :.:  ..||.:: |::......|...:.|:..||
  Fly   543 KPD--DNGVPNAILTLDNVTLDDRGEYKCIGRNA 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653
Ig 269..340 CDD:143165
IG_like 353..425 CDD:214653
IGc2 361..413 CDD:197706
I-set 433..527 CDD:254352
IGc2 446..517 CDD:197706
I-set 533..618 CDD:254352
IGc2 544..607 CDD:197706
Ig 641..714 CDD:143165
IGc2 735..804 CDD:197706 19/63 (30%)
I-set 819..914 CDD:254352 19/85 (22%)
Ig 833..921 CDD:299845 18/71 (25%)
FN3 918..1011 CDD:238020
FN3 1018..1116 CDD:238020
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
BsgNP_723346.2 IG_like 420..497 CDD:214653 19/74 (26%)
Ig 423..497 CDD:299845 19/74 (26%)
IG_like 500..583 CDD:214653 20/86 (23%)
Ig 512..575 CDD:143165 16/67 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10075
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.